DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C3G and Rasgrp3

DIOPT Version :9

Sequence 1:NP_572350.2 Gene:C3G / 31618 FlyBaseID:FBgn0259228 Length:1571 Species:Drosophila melanogaster
Sequence 2:XP_006239819.1 Gene:Rasgrp3 / 313874 RGDID:1304612 Length:691 Species:Rattus norvegicus


Alignment Length:236 Identity:57/236 - (24%)
Similarity:117/236 - (49%) Gaps:6/236 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1338 LKSLEIAEQMTLLDAELFTKIEIPEVLLFAKDQCEEKSPNLNKFTEHFNKMSYWARSKILRLQDA 1402
            |:.:|:||.:|.|:.:.|.:|...:...:....|.|.:|.|.:....||.:|.|.:..:|....|
  Rat   151 LEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVLSKPSA 215

  Fly  1403 KEREKHVNKFIKIMKHLRKMNNYNSYLALLSALDSGPIRRLE-----WQKGITEEVRSFCALIDS 1462
            ::|.:.:.|||.:.:.|.::.|:|:.:|::..|....|.||:     ....:|:.......|:.|
  Rat   216 QQRAEVITKFINVAQKLLQLKNFNTLMAVVGGLSHSSISRLKDTHSHLSSEVTKNWNEMTELVSS 280

  Fly  1463 SSSFRAYRQALAETNPPCIPYIGLILQDLTFVHVGNQDYLSKGVINFSKRWQQYNIIDNMKRFKK 1527
            :.::..||:|.|:.:...||.:|:.|:||..|||...|::.:..:|..|..|....:..:...:.
  Rat   281 NGNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWMEENKVNVVKMHQLSVTLSELVSLQN 345

  Fly  1528 CAYPFRRNERIIRFFDNFKD-FMGEEEMWQISEKIKPRGRR 1567
            .::....|..:|.......| :..|::::::|..::||..:
  Rat   346 ASHHLEPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSK 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C3GNP_572350.2 RasGEFN 1170..1306 CDD:214571
RasGEF 1335..1558 CDD:238087 54/225 (24%)
Rasgrp3XP_006239819.1 REM 11..126 CDD:100121
RasGEF 148..384 CDD:214539 56/232 (24%)
EF-hand_7 428..478 CDD:404394
C1_RASGRP3 488..546 CDD:410412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.