DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C3G and Ralgps2

DIOPT Version :9

Sequence 1:NP_572350.2 Gene:C3G / 31618 FlyBaseID:FBgn0259228 Length:1571 Species:Drosophila melanogaster
Sequence 2:XP_038946679.1 Gene:Ralgps2 / 304887 RGDID:1311537 Length:583 Species:Rattus norvegicus


Alignment Length:248 Identity:73/248 - (29%)
Similarity:126/248 - (50%) Gaps:29/248 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1342 EIAEQMTLLDAELFTKIEIPEVLLFAKDQCEEKS--PNLNKFTEHFNKMSYWARSKILRLQDAKE 1404
            |.|.|:||:|..:|..|:..|:.....::.|:.|  ||...||..||.:|:|...:||..|..|.
  Rat    52 EYAGQITLMDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKI 116

  Fly  1405 REKHVNKFIKIMKHLRKMNNYNSYLALLSALDSGPIRRL--EW------QKGITEEVRSFCALID 1461
            |.:.::.:||..|.|.::||.::.:|::|.|.|.||.||  .|      .|...|::....:..|
  Rat   117 RAEVLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKED 181

  Fly  1462 SSSSFRAYRQALAETNPPCIPYIGLILQDLTFVHVGNQDYLSKGVINFSKRWQQYNIIDNMKRF- 1525
            :....|.|..:|..|  |||||:|:.|.|||::   :..|.|.|.|  .:..|:.|:::|:.|. 
  Rat   182 NYKRLRDYISSLKMT--PCIPYLGIYLSDLTYI---DSAYPSTGSI--LENEQRSNLMNNILRII 239

  Fly  1526 ----KKCAYPF------RRNERIIRFFDNFKDFMGEEEMWQISEKIKPRGRRP 1568
                :.|.|..      ::....:::.:..:.|: |::.:::|.||:|....|
  Rat   240 SDLQQSCEYDIPMLPHVQKYLNSVQYIEELQKFV-EDDNYKLSLKIEPGASTP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C3GNP_572350.2 RasGEFN 1170..1306 CDD:214571
RasGEF 1335..1558 CDD:238087 68/236 (29%)
Ralgps2XP_038946679.1 RasGEF 45..286 CDD:214539 71/241 (29%)
PH_RalGPS1_2 459..574 CDD:270120
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.