DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C3G and Rasgrp1

DIOPT Version :9

Sequence 1:NP_572350.2 Gene:C3G / 31618 FlyBaseID:FBgn0259228 Length:1571 Species:Drosophila melanogaster
Sequence 2:XP_038960368.1 Gene:Rasgrp1 / 29434 RGDID:3539 Length:818 Species:Rattus norvegicus


Alignment Length:438 Identity:93/438 - (21%)
Similarity:173/438 - (39%) Gaps:93/438 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1171 GPEVKGGYIDALIVHASRVQKV-ADNAFC------EAFITTFRTFIQPIDVIEKLTHRYTYFFCQ 1228
            |...||..:|.||  .|.:|.. ||...|      :..:|..|..|...::::||.:.|      
  Rat    77 GHLAKGASLDDLI--DSCIQSFDADGNLCRSNQLLQVMLTMHRIIISSAELLQKLMNLY------ 133

  Fly  1229 VQDNKQKAAK--------------ETFALLVRVVNDLTSTDLTSQLLSLLVEFVYQLVCSGQLYL 1279
             :|..:|.:.              ..|.::.::...||||         :.||...:..:|:...
  Rat   134 -KDALEKNSPGICLKICYFVRYWITEFWIMFKMDASLTST---------MEEFQDLVKANGEESH 188

  Fly  1280 AKLL----------RNKFVEKV--TLYKEPKVYGFVGELGGAGSVGGAGIAGSGGCSGTAGGGNQ 1332
            ..|:          ..|..:::  ...|:.||                                 
  Rat   189 CHLIDTTQINSRDWSRKLTQRIKSNTSKKRKV--------------------------------- 220

  Fly  1333 PSLL--DLKSLEIAEQMTLLDAELFTKIEIPEVLLFAKDQCEEKSPNLNKFTEHFNKMSYWARSK 1395
             |||  .|:..|::|.:|.|:.:.|.:|...:...:..:.|.:::|.:.:.....|.:|.|.:..
  Rat   221 -SLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLM 284

  Fly  1396 ILRLQDAKEREKHVNKFIKIMKHLRKMNNYNSYLALLSALDSGPIRRL-EWQKGITEEVR----S 1455
            :|.....:.|.:...|||.:.:.|.::.|:|:.:|::..|....|.|| |....:..|:.    .
  Rat   285 VLSRPTPQLRAEVFIKFIHVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGE 349

  Fly  1456 FCALIDSSSSFRAYRQALAETNPPCIPYIGLILQDLTFVHVGNQDYLSKGVINFSKRWQQYNIID 1520
            ...|:.|..::..||:|..|.....||.:|:.|:||..::....|||..|.:|..|....||.|:
  Rat   350 MTELLSSCRNYDNYRRAYGECTHFKIPILGVHLKDLISLYEAMPDYLEDGKVNVQKLLALYNHIN 414

  Fly  1521 NMKRFKKCAYPFRRNERIIRFFDNFKD-FMGEEEMWQISEKIKPRGRR 1567
            .:.:.:..|.|...|:.::.......| :..|:|::::|...:||..|
  Rat   415 ELVQLQDVAPPLDANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHR 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C3GNP_572350.2 RasGEFN 1170..1306 CDD:214571 32/167 (19%)
RasGEF 1335..1558 CDD:238087 56/230 (24%)
Rasgrp1XP_038960368.1 RasGEFN 77..199 CDD:214571 28/139 (20%)
RasGEF 224..460 CDD:214539 56/235 (24%)
EF-hand_7 501..550 CDD:404394
C1_RASGRP1 563..617 CDD:410410
cc_RasGRP1_C 760..814 CDD:412086
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.