DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C3G and Ralgps1

DIOPT Version :9

Sequence 1:NP_572350.2 Gene:C3G / 31618 FlyBaseID:FBgn0259228 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_780420.1 Gene:Ralgps1 / 241308 MGIID:1922008 Length:585 Species:Mus musculus


Alignment Length:250 Identity:72/250 - (28%)
Similarity:129/250 - (51%) Gaps:32/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1342 EIAEQMTLLDAELFTKIEIPEVLL---FAKDQCEEKSPNLNKFTEHFNKMSYWARSKILRLQDAK 1403
            |.|.|:||:|..:|..|: ||.|.   ::|.:....:||:..||..||::|:|...:||..|..|
Mouse    53 EFASQITLMDIPVFKAIQ-PEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLK 116

  Fly  1404 EREKHVNKFIKIMKHLRKMNNYNSYLALLSALDSGPIRRL--EW------QKGITEEVRSFCALI 1460
            .|.:.::.|:||.|.|.::||.:|.::::|||.|.||.||  .|      .|...|::....:..
Mouse   117 IRAEILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSKE 181

  Fly  1461 DSSSSFRAYRQALAETNPPCIPYIGLILQDLTFVHVGNQDYLSKGVINFSKRWQQYNIIDNMKRF 1525
            |:....|.|.::|...  |.|||:|:.|.||.::   :..|.:.|.|  .:..|:.|.::|:.|.
Mouse   182 DNYKRTRDYIRSLKMV--PSIPYLGIYLLDLIYI---DSAYPASGSI--MENEQRSNQMNNILRI 239

  Fly  1526 -----KKCAYP-------FRRNERIIRFFDNFKDFMGEEEMWQISEKIKPRGRRP 1568
                 ..|:|.       .::..:.:|:.:..:.|: |::.:::|.:|:|....|
Mouse   240 IADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFV-EDDNYKLSLRIEPGSSSP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C3GNP_572350.2 RasGEFN 1170..1306 CDD:214571
RasGEF 1335..1558 CDD:238087 68/238 (29%)
Ralgps1NP_780420.1 RasGEF 46..288 CDD:214539 70/243 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..342 0/4 (0%)
PXXP 330..333
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..410
Required for stimulation of nucleotide exchange by RALA. /evidence=ECO:0000250 461..585
PH_RalGPS1_2 461..576 CDD:270120
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.