DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C3G and Rasgrp3

DIOPT Version :9

Sequence 1:NP_572350.2 Gene:C3G / 31618 FlyBaseID:FBgn0259228 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_001159965.1 Gene:Rasgrp3 / 240168 MGIID:3028579 Length:691 Species:Mus musculus


Alignment Length:236 Identity:57/236 - (24%)
Similarity:117/236 - (49%) Gaps:6/236 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1338 LKSLEIAEQMTLLDAELFTKIEIPEVLLFAKDQCEEKSPNLNKFTEHFNKMSYWARSKILRLQDA 1402
            |:.:|:||.:|.|:.:.|.:|...:...:....|.|.:|.|.:....||.:|.|.:..:|....|
Mouse   151 LEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENNPTLERSIALFNGISKWVQLMVLSKPSA 215

  Fly  1403 KEREKHVNKFIKIMKHLRKMNNYNSYLALLSALDSGPIRRLE-----WQKGITEEVRSFCALIDS 1462
            ::|.:.:.|||.:.:.|.::.|:|:.:|::..|....|.||:     ....:|:.......|:.|
Mouse   216 QQRAEVITKFINVAQKLLQLKNFNTLMAVVGGLSHSSISRLKDTHSHLSSEVTKNWNEMTELVSS 280

  Fly  1463 SSSFRAYRQALAETNPPCIPYIGLILQDLTFVHVGNQDYLSKGVINFSKRWQQYNIIDNMKRFKK 1527
            :.::..||:|.|:.:...||.:|:.|:||..|||...|::.:..:|..|..|....:..:...:.
Mouse   281 NGNYCNYRKAFADCDGFKIPILGVHLKDLIAVHVIFPDWMEENKVNVVKMHQLSVTLSELVSLQN 345

  Fly  1528 CAYPFRRNERIIRFFDNFKD-FMGEEEMWQISEKIKPRGRR 1567
            .::....|..:|.......| :..|::::::|..::||..:
Mouse   346 ASHHLEPNMDLINLLTLSLDLYHTEDDIYKLSLVLEPRNSK 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C3GNP_572350.2 RasGEFN 1170..1306 CDD:214571
RasGEF 1335..1558 CDD:238087 54/225 (24%)
Rasgrp3NP_001159965.1 REM 11..126 CDD:100121
RasGEF 148..384 CDD:214539 56/232 (24%)
EF-hand_7 428..478 CDD:372618
C1 495..544 CDD:237996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.