DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C3G and RASGRP2

DIOPT Version :9

Sequence 1:NP_572350.2 Gene:C3G / 31618 FlyBaseID:FBgn0259228 Length:1571 Species:Drosophila melanogaster
Sequence 2:XP_016872571.1 Gene:RASGRP2 / 10235 HGNCID:9879 Length:898 Species:Homo sapiens


Alignment Length:255 Identity:63/255 - (24%)
Similarity:122/255 - (47%) Gaps:34/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1334 SLL--DLKSLEIAEQMTLLDAELFTKIEIPEVLLFAKDQCEEKSPNLNKFTEHFNKMSYWARSKI 1396
            |||  .|:.:|:||.:|.|:...|.||...:...|....|...:|.|.:|...||.:|.|.:..|
Human   435 SLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLMI 499

  Fly  1397 LRLQDAKEREKHVNKFIKIMKHLRKMNNYNSYLALLSALDSGPIRRLE-------------WQKG 1448
            |....|.:|...:..|:.:.:.|.::.|:|:.:|::..|....|.||:             |: |
Human   500 LSKPTAPQRALVITHFVHVAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPETIKLWE-G 563

  Fly  1449 ITEEVRSFCALIDSSSSFRAYRQALAETNPPCI----PYIGLILQDLTFVHVGNQDYL--SKGVI 1507
            :||       |:.::.::..||:.||    .|:    |.:|:.|:||..:.:...|:|  ::..:
Human   564 LTE-------LVTATGNYGNYRRRLA----ACVGFRFPILGVHLKDLVALQLALPDWLDPARTRL 617

  Fly  1508 NFSKRWQQYNIIDNMKRFKKCAYPFRRNERIIRFFD-NFKDFMGEEEMWQISEKIKPRGR 1566
            |.:|..|.::|::.:........|.:.|..::.... :...:..|:|::|:|.:.:||.:
Human   618 NGAKMKQLFSILEELAMVTSLRPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSK 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C3GNP_572350.2 RasGEFN 1170..1306 CDD:214571
RasGEF 1335..1558 CDD:238087 59/244 (24%)
RASGRP2XP_016872571.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.