DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C3G and ralgps1

DIOPT Version :9

Sequence 1:NP_572350.2 Gene:C3G / 31618 FlyBaseID:FBgn0259228 Length:1571 Species:Drosophila melanogaster
Sequence 2:XP_031746936.1 Gene:ralgps1 / 100495235 XenbaseID:XB-GENE-996181 Length:622 Species:Xenopus tropicalis


Alignment Length:317 Identity:85/317 - (26%)
Similarity:150/317 - (47%) Gaps:46/317 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1289 EKVTLYKEPKV-YGFVGELGG-AGSVGGAGIAGSGGCSGTAGGGNQP------------SLLDLK 1339
            :::.|.|.|.: :|.:.:..| ..||........|..|..:..|...            .:|.:.
 Frog     7 QQLRLAKSPSIPWGSMYKRNGLMASVTVTAATPEGSSSSDSMDGQSSDYANKSYDAVVFDVLKVT 71

  Fly  1340 SLEIAEQMTLLDAELFTKIEIPEVLLFAKDQCEEK---SPNLNKFTEHFNKMSYWARSKILRLQD 1401
            ..|.|.|:||:|..:|.:| :||.|.......:||   :||:..||..||::|:|...:||..|.
 Frog    72 PEEFASQITLMDVPVFKEI-LPEELASCGWNKKEKHILAPNVVAFTRRFNQVSFWVVREILTAQT 135

  Fly  1402 AKEREKHVNKFIKIMKHLRKMNNYNSYLALLSALDSGPIRRL--EW------QKGITEEVRSFCA 1458
            .|.|.:.::.|:||.|.|.::||.:|.:|::|||.|.||.||  .|      .|...|::....:
 Frog   136 LKIRAEILSHFVKIAKKLLELNNIHSLMAVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLLS 200

  Fly  1459 LIDSSSSFRAYRQALAETNPPCIPYIGLILQDLTFVHVGNQDYLSKGVINFSKRWQQYNIIDNMK 1523
            ..|:....|.:.::|...  |||||:||.|.|:.::   :..|.:.|.|  .:..|:.|.::|:.
 Frog   201 KEDNCKRMREHIRSLKMV--PCIPYLGLYLLDIIYI---DSAYPASGSI--MENEQRTNQMNNIL 258

  Fly  1524 RF-----KKCAYP-------FRRNERIIRFFDNFKDFMGEEEMWQISEKIKPRGRRP 1568
            |.     ..|.|.       .::..:.:|:.:..:.|: |::.:::|.:|:|....|
 Frog   259 RIIADLQVSCIYDHLVTLPHVQKYLKSVRYIEELQKFV-EDDNYKLSLRIEPGNSSP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C3GNP_572350.2 RasGEFN 1170..1306 CDD:214571 4/17 (24%)
RasGEF 1335..1558 CDD:238087 71/245 (29%)
ralgps1XP_031746936.1 RasGEF 67..311 CDD:214539 74/252 (29%)
PH_RalGPS1_2 499..613 CDD:270120
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.