DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C3G and ralgps1

DIOPT Version :9

Sequence 1:NP_572350.2 Gene:C3G / 31618 FlyBaseID:FBgn0259228 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_001093616.1 Gene:ralgps1 / 100101642 ZFINID:ZDB-GENE-070720-16 Length:581 Species:Danio rerio


Alignment Length:257 Identity:79/257 - (30%)
Similarity:132/257 - (51%) Gaps:32/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1335 LLDLKSLEIAEQMTLLDAELFTKIEIPEVLL---FAKDQCEEKSPNLNKFTEHFNKMSYWARSKI 1396
            :|.:...|.|.|:||:||.:|..|: ||.|.   :.|.:....|||:..||..||::|:||..:|
Zfish    45 MLKVTPEEFASQITLMDAPVFKAIQ-PEELASCGWNKKEKHSLSPNVVAFTRRFNQVSFWAVREI 108

  Fly  1397 LRLQDAKEREKHVNKFIKIMKHLRKMNNYNSYLALLSALDSGPIRRLE--W------QKGITEEV 1453
            |..|..|.|.:.:..||||.|.|.::||.:|.::::|||.|.||.||.  |      .|...|::
Zfish   109 LTAQTLKIRAEILGHFIKIAKKLLELNNLHSLVSVVSALQSAPIFRLSKTWALISRKDKATFEKL 173

  Fly  1454 RSFCALIDSSSSFRAYRQALAETNPPCIPYIGLILQDLTFVHVGNQDY-LSKGVINFSKRWQQYN 1517
            ....:..::.:..|.|.::|...  |||||:|:.|.|:|::   :..| .|..:|...:|..|.|
Zfish   174 DFLTSKEENYNRMREYTRSLKMA--PCIPYLGIYLFDMTYI---DSAYPASDSIIETEQRTNQMN 233

  Fly  1518 ----IIDNMKRFKKCAYP-------FRRNERIIRFFDNFKDFMGEEEMWQISEKIKPRGRRP 1568
                ||.:::  ..|.|.       .::....:|:.:..:.|: |::.:.:|.||:|....|
Zfish   234 NLLRIISDLQ--VSCKYDHLITLPHVQKYLMSVRYIEELQKFV-EDDNYSLSLKIEPGNSSP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C3GNP_572350.2 RasGEFN 1170..1306 CDD:214571
RasGEF 1335..1558 CDD:238087 74/245 (30%)
ralgps1NP_001093616.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
RasGEF 46..289 CDD:214539 78/251 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..339
PXXP 329..332
PH 456..567 CDD:278594
PH_RalGPS1_2 457..572 CDD:270120
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.