DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shf and vwde

DIOPT Version :9

Sequence 1:NP_001284963.1 Gene:shf / 31617 FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001070239.2 Gene:vwde / 767804 ZFINID:ZDB-GENE-060929-1226 Length:212 Species:Danio rerio


Alignment Length:186 Identity:67/186 - (36%)
Similarity:90/186 - (48%) Gaps:11/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 DASNPTSLTTLQAPDPECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSV 334
            |.....:|..:..|...|...|...|.|..::.|.|:.||.|:.|:.|.|:|:|.|||.|..|..
Zfish    30 DGPRGVALPFVFDPKATCDPPCKHAGICIRNNTCFCSRGYEGETCQFANCYPKCKNGGECLRPGK 94

  Fly   335 CTCPEGYQGTQCEGGICKDKCLNGGKCIQ---KDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGN 396
            |.||.|:.|..|...:|...|.|||:|..   :.||.|...:.|.||:.:.|...|||.|.|:..
Zfish    95 CRCPSGFGGKFCHRVVCDAGCWNGGECTAVNGEAKCICPSSWTGSRCQDAICPQGCKNGGICVAP 159

  Fly   397 NLCRCPNGLRGDHCEIGRKQRSICK--CRN-GTCVSHKHCKCHPGFYGRHCNGRKR 449
            .:|.||:|..|..|     ..::||  |.| |.|||...|:|...|.|..|..||:
Zfish   160 GICSCPDGWIGGAC-----HTAVCKKPCVNGGKCVSPNTCRCRGLFTGPQCEERKK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shfNP_001284963.1 WIF 137..258 CDD:280237
vwdeNP_001070239.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I4978
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.