DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shf and TNN

DIOPT Version :9

Sequence 1:NP_001284963.1 Gene:shf / 31617 FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster
Sequence 2:XP_016857537.1 Gene:TNN / 63923 HGNCID:22942 Length:1317 Species:Homo sapiens


Alignment Length:311 Identity:67/311 - (21%)
Similarity:97/311 - (31%) Gaps:98/311 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 DESILKA-----PTLSIRKSGRIPQEQKNFSIFL----PCTGNSSGTASFNVGLKIQTRHNKPLS 249
            :.|||:.     |.:|:::..|.|......|:.|    |.|....|.:  |...::...|     
Human     5 EHSILEGLLPVFPRMSLQEMFRFPMGLLLGSVLLVASAPATLEPPGCS--NKEQQVTVSH----- 62

  Fly   250 GTPIRLNFKKECAHRGVYDIDASNPTSLT------------------------TLQAPDPECSLK 290
                  .:|.:.....:..:|| :|..|:                        .||.|..:|.| 
Human    63 ------TYKIDVPKSALVQVDA-DPQPLSDDGASLLALGEAREEQNIIFRHNIRLQTPQKDCEL- 119

  Fly   291 CGK------------------NGYCNEHHICKCNVGYT--GQYC--ETAFCFPQCLNGGNCTAPS 333
            .|.                  ...|:....|:   |.|  .::|  ...|....|          
Human   120 AGSVQDLLARVKKLEEEMVEMKEQCSAQRCCQ---GVTDLSRHCSGHGTFSLETC---------- 171

  Fly   334 VCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNL 398
            .|.|.||.:|..||...|...|...|:|:. .:|.|.:.|.|..|.|..|...|...|.|: ..:
Human   172 SCHCEEGREGPACERLACPGACSGHGRCVD-GRCLCHEPYVGADCGYPACPENCSGHGECV-RGV 234

  Fly   399 CRCPNGLRGDHCEIGRKQRSICKCRNGTCVSH-----KHCKCHPGFYGRHC 444
            |:|......:.|...|     |.   |.|..|     ..|.|..||.|..|
Human   235 CQCHEDFMSEDCSEKR-----CP---GDCSGHGFCDTGECYCEEGFTGLDC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shfNP_001284963.1 WIF 137..258 CDD:280237 14/72 (19%)
TNNXP_016857537.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1225
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.