DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shf and Itgb6

DIOPT Version :9

Sequence 1:NP_001284963.1 Gene:shf / 31617 FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001004263.1 Gene:Itgb6 / 311061 RGDID:1303119 Length:787 Species:Rattus norvegicus


Alignment Length:401 Identity:88/401 - (21%)
Similarity:129/401 - (32%) Gaps:137/401 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NRNEESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRVTNDLRDTTLYNFLVIPSEVN-YVN 173
            ||||.|            |.|.|.:|     .:..:.:..|.|::    |..|.|...:|: |.|
  Rat   297 NRNEYS------------MSTVLEYP-----TIGQLIDKLVQNNV----LLIFAVTQEQVHLYEN 340

  Fly   174 FTWKSGRRKYFYDFDRLQTMDESILKAPTLSI--RKSGRIPQ------EQKNFSIFLPCTGNSSG 230
            :.                    .::...|:.:  :.||.|.|      |:....:.|...|::.|
  Rat   341 YA--------------------KLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEG 385

  Fly   231 ----------------------------TASFNVGLKIQT--RHNKPLSGTPIRLNFKKECAHRG 265
                                        ||||||.:.|..  :.::.|...|:.|....|.....
  Rat   386 LNLSFTALCSNGILFPHQKKCSHMKVGDTASFNVSVSITNCEKRSRKLIIKPVGLGDTLEILVSA 450

  Fly   266 VYDIDASNPTSLTTLQAPDPECSLKCGKNGYCNEHHICKCNVGYTGQYCE-------TAFC---- 319
            ..|.|........:.:......|.:||         :|.||.|:.|..||       |..|    
  Rat   451 ECDCDCQREVEANSSKCHHGNGSFQCG---------VCACNPGHMGPRCECGEDMVSTDSCKESP 506

  Fly   320 -FPQCLNGGNCTAPSVCTCPEGYQGT------QCEGGIC-KDK---CLNGGKCIQKDKCQCSKGY 373
             .|.|...|:|.. ..|.|.....|:      ||:...| :.|   |.:.|.| ...:|.|..|:
  Rat   507 GHPSCSGRGDCYC-GQCVCHLSPYGSIYGPYCQCDNFSCLRHKGLLCGDNGDC-DCGECVCRDGW 569

  Fly   374 YGLRCEYSKCV-----------IPCKNEGRCI-GNNLCRCPNGLRGDHCEIGRKQRSICKCRNGT 426
            .|   ||..|.           :.|...|.|: |..:||.| |..|..||       .|......
  Rat   570 TG---EYCNCTTSRDACASEDGVLCSGRGDCVCGKCVCRNP-GASGPTCE-------RCPTCGDP 623

  Fly   427 CVSHKHC-KCH 436
            |.|.:.| :|:
  Rat   624 CNSRRSCIECY 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shfNP_001284963.1 WIF 137..258 CDD:280237 27/159 (17%)
Itgb6NP_001004263.1 Integrin_beta 30..454 CDD:278776 37/197 (19%)
Cysteine-rich tandem repeats 456..619 45/184 (24%)
Integrin_B_tail 624..705 CDD:285239 4/11 (36%)
Interaction with HAX1. /evidence=ECO:0000250 730..757
Integrin_b_cyt 732..774 CDD:285884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.