Sequence 1: | NP_001284963.1 | Gene: | shf / 31617 | FlyBaseID: | FBgn0003390 | Length: | 460 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001100659.2 | Gene: | Tnn / 304913 | RGDID: | 1306002 | Length: | 1562 | Species: | Rattus norvegicus |
Alignment Length: | 234 | Identity: | 54/234 - (23%) |
---|---|---|---|
Similarity: | 81/234 - (34%) | Gaps: | 55/234 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 261 CAHRG-------VYDIDA---------SNPTSLT------------------------TLQAPDP 285
Fly 286 ECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFP-------QCLNGGNCTAPSV-CTCPEGYQ 342
Fly 343 GTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRG 407
Fly 408 DHCEIGRKQRSICKCR-NGTCVSHKHCKCHPGFYGRHCN 445 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
shf | NP_001284963.1 | WIF | 137..258 | CDD:280237 | |
Tnn | NP_001100659.2 | EGF_2 | <142..166 | CDD:285248 | 7/23 (30%) |
EGF_2 | 169..197 | CDD:285248 | 8/28 (29%) | ||
EB | 181..233 | CDD:279949 | 15/56 (27%) | ||
EGF_2 | 233..259 | CDD:285248 | 9/26 (35%) | ||
fn3 | 264..332 | CDD:278470 | |||
fn3 | 359..434 | CDD:278470 | |||
fn3 | 444..521 | CDD:278470 | |||
FN3 | 532..608 | CDD:214495 | |||
FN3 | 620..696 | CDD:214495 | |||
fn3 | 708..785 | CDD:278470 | |||
fn3 | 796..875 | CDD:278470 | |||
fn3 | 884..961 | CDD:278470 | |||
fn3 | 972..1049 | CDD:278470 | |||
FN3 | 1060..1136 | CDD:214495 | |||
FN3 | 1148..1224 | CDD:214495 | |||
fn3 | 1236..1313 | CDD:278470 | |||
FReD | 1327..1540 | CDD:238040 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1225 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |