DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shf and Tnn

DIOPT Version :9

Sequence 1:NP_001284963.1 Gene:shf / 31617 FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001100659.2 Gene:Tnn / 304913 RGDID:1306002 Length:1562 Species:Rattus norvegicus


Alignment Length:234 Identity:54/234 - (23%)
Similarity:81/234 - (34%) Gaps:55/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 CAHRG-------VYDIDA---------SNPTSLT------------------------TLQAPDP 285
            |:|:.       .|.||.         ::|.||:                        .||.|..
  Rat    33 CSHKDQQVTVSHTYKIDVPKSALVQVETDPQSLSDDGTSLLVPGEDGEEQNIIFRHNIRLQTPQK 97

  Fly   286 ECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFP-------QCLNGGNCTAPSV-CTCPEGYQ 342
            .|.|..............:..:....:.|.|:.|..       .|...|...|.:. |.|.:|::
  Rat    98 NCELADSVQDLLARVKKLEEEMAELKEQCSTSRCCQGAADLSRHCSGHGTFFAETCSCHCDQGWE 162

  Fly   343 GTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRG 407
            |..||...|...|...|:|:. .:|.|.:.|.|:.|.|:.|...|...|.|: ..:|:|......
  Rat   163 GADCEQPTCPGACSGHGRCVD-GQCVCDQPYVGVDCAYAACPQDCSGHGVCV-RGVCQCHKDFTA 225

  Fly   408 DHCEIGRKQRSICKCR-NGTCVSHKHCKCHPGFYGRHCN 445
            :.|.   :||....|. ||.|.:.: |.|..||.|..|:
  Rat   226 EDCS---EQRCPGDCSGNGFCDTGE-CYCEMGFTGPDCS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shfNP_001284963.1 WIF 137..258 CDD:280237
TnnNP_001100659.2 EGF_2 <142..166 CDD:285248 7/23 (30%)
EGF_2 169..197 CDD:285248 8/28 (29%)
EB 181..233 CDD:279949 15/56 (27%)
EGF_2 233..259 CDD:285248 9/26 (35%)
fn3 264..332 CDD:278470
fn3 359..434 CDD:278470
fn3 444..521 CDD:278470
FN3 532..608 CDD:214495
FN3 620..696 CDD:214495
fn3 708..785 CDD:278470
fn3 796..875 CDD:278470
fn3 884..961 CDD:278470
fn3 972..1049 CDD:278470
FN3 1060..1136 CDD:214495
FN3 1148..1224 CDD:214495
fn3 1236..1313 CDD:278470
FReD 1327..1540 CDD:238040
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1225
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.