DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shf and tnn

DIOPT Version :9

Sequence 1:NP_001284963.1 Gene:shf / 31617 FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster
Sequence 2:XP_005171321.1 Gene:tnn / 30234 ZFINID:ZDB-GENE-990415-262 Length:1020 Species:Danio rerio


Alignment Length:237 Identity:63/237 - (26%)
Similarity:90/237 - (37%) Gaps:61/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 LNFKKECAHRGVYDIDA-----SNPTSLTTLQAPDPECSLKCGKNGYCNEHHI------CKC--- 305
            :|.:||.....||.||:     |....|:..||.:.:.....|:|....:|.|      |.|   
Zfish    31 VNAEKEVTFSHVYRIDSSCKQGSQVGQLSQDQASEGQLVTVNGENDIVFKHSIRLQPAGCGCADS 95

  Fly   306 ---------------NVGYTGQYCETAFCFPQCLNGG-----NCTAPSV-------CTCPEGYQG 343
                           .|.|....|...     |..||     :|:....       |.|..|::|
Zfish    96 EDFKALLYRVNGLEEEVNYLKSQCAQG-----CCKGGAGVDTSCSGHGTYQQDSCSCKCNPGWEG 155

  Fly   344 TQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGD 408
            ..|....|.|:|.:.|:|:. .:|.|.:||.|..|....|...||::|.|: :..|.|.:|..|:
Zfish   156 PDCSISSCPDECNDNGRCVD-GRCVCYEGYTGHDCSQLTCPNDCKDKGHCV-DGKCVCFSGFSGE 218

  Fly   409 HCEIGRKQRSICKC-----RNGTCVSHKHCKCHPGFYGRHCN 445
            .|       ||..|     .||.||..: |.|..||:|..|:
Zfish   219 DC-------SIATCPNDCIGNGRCVDGQ-CICDEGFFGIDCS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shfNP_001284963.1 WIF 137..258 CDD:280237 1/2 (50%)
tnnXP_005171321.1 EGF_alliinase <133..163 CDD:282688 6/29 (21%)
EGF_2 161..189 CDD:285248 10/28 (36%)
EGF_2 193..220 CDD:285248 9/27 (33%)
EGF_2 224..251 CDD:285248 10/27 (37%)
fn3 257..333 CDD:278470
fn3 344..426 CDD:278470
fn3 435..514 CDD:278470
fn3 523..602 CDD:278470
fn3 611..683 CDD:278470
fn3 699..773 CDD:278470
FReD 792..1003 CDD:238040
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1225
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.