| Sequence 1: | NP_001284963.1 | Gene: | shf / 31617 | FlyBaseID: | FBgn0003390 | Length: | 460 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001299845.1 | Gene: | tncb / 30037 | ZFINID: | ZDB-GENE-980526-104 | Length: | 1811 | Species: | Danio rerio |
| Alignment Length: | 205 | Identity: | 69/205 - (33%) |
|---|---|---|---|
| Similarity: | 84/205 - (40%) | Gaps: | 27/205 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 260 ECAHRGVYDIDASNPTSLTTLQAPDPEC-SLKCGKNGYCNEHHICK-----CNVGYTGQYCETAF 318
Fly 319 CFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKC 383
Fly 384 VIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSIC--KCR-NGTCVSHKHCKCHPGFYGRHCN 445
Fly 446 GRKR--RHVH 453 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| shf | NP_001284963.1 | WIF | 137..258 | CDD:280237 | |
| tncb | NP_001299845.1 | DnaJ | <471..>544 | CDD:333066 | 3/8 (38%) |
| fn3 | 689..760 | CDD:306538 | |||
| fn3 | 778..858 | CDD:306538 | |||
| fn3 | 868..948 | CDD:306538 | |||
| FN3 | 958..1047 | CDD:238020 | |||
| fn3 | 1050..1128 | CDD:306538 | |||
| fn3 | 1140..1215 | CDD:306538 | |||
| fn3 | 1231..1303 | CDD:306538 | |||
| fn3 | 1323..1400 | CDD:306538 | |||
| fn3 | 1410..1482 | CDD:306538 | |||
| fn3 | 1498..1570 | CDD:306538 | |||
| FReD | 1589..1798 | CDD:238040 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1225 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||