DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shf and Wif1

DIOPT Version :9

Sequence 1:NP_001284963.1 Gene:shf / 31617 FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_036045.1 Gene:Wif1 / 24117 MGIID:1344332 Length:379 Species:Mus musculus


Alignment Length:341 Identity:115/341 - (33%)
Similarity:170/341 - (49%) Gaps:40/341 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 ESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRV---TNDLRDTTLYNFLVIPSEVNYVNFT 175
            |..:.|||:..|.::|.      |:.|.:..:...::   |:|.|... .....||..::.:|||
Mouse    33 EESLYLWIDAHQARVLI------GFEEDILIVSEGKMAPFTHDFRKAQ-QRMPAIPVNIHSMNFT 90

  Fly   176 WK-SGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLK 239
            |: :|:.:|||:|..|:::|:.|:..||:::...|.:|.:.....:..||.|...|.|:|.|.:.
Mouse    91 WQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVI 155

  Fly   240 IQTRHNKPLSGTPIRLNFKKECAHRGVYDIDASNPTSLTTLQAPDPECSLKCGKNGYCNEHHICK 304
            :.......:..||....|.|.|.                  ||   ||...|...|:|||..:|:
Mouse   156 VMNSEGNTILRTPQNAIFFKTCQ------------------QA---ECPGGCRNGGFCNERRVCE 199

  Fly   305 CNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQC 369
            |..|:.|.:||.|.|.|:|:|||.|..|..|.||.|:.|..|:...|...|.|||.|....||.|
Mouse   200 CPDGFYGPHCEKALCIPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCIC 264

  Fly   370 SKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICK--C-RNGTCVSHK 431
            ..|..|.:||.|||..||:|.|:|||.:.|:||.|.:||.|     .:.:|:  | .:|||....
Mouse   265 PPGLEGEQCELSKCPQPCRNGGKCIGKSKCKCPKGYQGDLC-----SKPVCEPGCGAHGTCHEPN 324

  Fly   432 HCKCHPGFYGRHCNGR 447
            .|:|..|::|||||.|
Mouse   325 KCQCREGWHGRHCNKR 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shfNP_001284963.1 WIF 137..258 CDD:280237 32/124 (26%)
Wif1NP_036045.1 WIF 35..179 CDD:128745 40/168 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9733
eggNOG 1 0.900 - - E1_KOG1225
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31430
Inparanoid 1 1.050 232 1.000 Inparanoid score I3422
Isobase 1 0.950 - 0 Normalized mean entropy S5912
OMA 1 1.010 - - QHG47613
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007895
OrthoInspector 1 1.000 - - oto94704
orthoMCL 1 0.900 - - OOG6_109902
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4825
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.750

Return to query results.
Submit another query.