Sequence 1: | NP_001284963.1 | Gene: | shf / 31617 | FlyBaseID: | FBgn0003390 | Length: | 460 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_505019.2 | Gene: | txt-5 / 183289 | WormBaseID: | WBGene00016499 | Length: | 356 | Species: | Caenorhabditis elegans |
Alignment Length: | 204 | Identity: | 59/204 - (28%) |
---|---|---|---|
Similarity: | 80/204 - (39%) | Gaps: | 51/204 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 280 LQAPDPECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSV-----CTCPE 339
Fly 340 GYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEY-SKCVIPCKNEGRCIGNNLCRCPN 403
Fly 404 GLRGDHCE-----IGR---KQRSI-CKC-------RNGTCVSH-------KHCKCHPGFYGRHCN 445
Fly 446 GRKRRHVHR 454 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
shf | NP_001284963.1 | WIF | 137..258 | CDD:280237 | |
txt-5 | NP_505019.2 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1225 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |