DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment shf and irg-7

DIOPT Version :9

Sequence 1:	NP_001284963.1	Gene:	shf / 31617	FlyBaseID:	FBgn0003390	Length:	460	Species:	Drosophila melanogaster
Sequence 2:	NP_001362066.1	Gene:	irg-7 / 180613	WormBaseID:	WBGene00018237	Length:	2217	Species:	Caenorhabditis elegans

Alignment Length:	143	Identity:	39/143 - (27%)
Similarity:	53/143 - (37%)	Gaps:	46/143 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   210 RIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSGTPIRLNFKKECAHRGVYDIDASNP 274
            |:|:|...|:.|          |..|..:.:|.      :||..       ||        |.:|
Worm   803 RVPEEVLYFNFF----------ARDNNDMALQR------AGTMF-------CA--------AVHP 836

  Fly   275 TSLTTLQAPDPECSLKCGKNGYCN-EHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCP 338
            |       |.|:  .:|...|..| .:..|.|...:||.||:...|:    |||..:... |.||
Worm   837 T-------PPPD--HQCQNGGVMNPSNTTCFCTPEFTGTYCQNIICY----NGGTASGDH-CVCP 887

  Fly   339 EGYQGTQCEGGIC 351
            .||.|..||...|
Worm   888 PGYAGESCEMARC 900

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
shf	NP_001284963.1	WIF	137..258	CDD:280237	10/47 (21%)
irg-7	NP_001362066.1	MD	181..319	CDD:214741
		CLECT	1181..1313	CDD:214480
		MD	1328..1469	CDD:214741
		EGF_2	1474..1503	CDD:285248
		VWA	2016..2194	CDD:365868
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1016037at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010