Sequence 1: | NP_001284963.1 | Gene: | shf / 31617 | FlyBaseID: | FBgn0003390 | Length: | 460 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_500723.1 | Gene: | C02B10.3 / 177284 | WormBaseID: | WBGene00015328 | Length: | 247 | Species: | Caenorhabditis elegans |
Alignment Length: | 202 | Identity: | 54/202 - (26%) |
---|---|---|---|
Similarity: | 76/202 - (37%) | Gaps: | 61/202 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 259 KECAHRGVYDIDASNPTSLTTLQAPDPEC-------SLKCGKNGYCNEHHICKCNVGYTGQYC-- 314
Fly 315 -------ETAF---CFP-QCLNGGNCTAPS---VCTCPEGYQGTQCEGGICKDKCL--------N 357
Fly 358 GGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICKC 422
Fly 423 RNGTCVS 429 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
shf | NP_001284963.1 | WIF | 137..258 | CDD:280237 | |
C02B10.3 | NP_500723.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1225 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |