DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shf and dsl-3

DIOPT Version :9

Sequence 1:NP_001284963.1 Gene:shf / 31617 FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_500108.1 Gene:dsl-3 / 176970 WormBaseID:WBGene00001105 Length:263 Species:Caenorhabditis elegans


Alignment Length:86 Identity:31/86 - (36%)
Similarity:38/86 - (44%) Gaps:11/86 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 CPEGYQGTQCEGGICKDKCLNGGK-CIQKDKCQCSKGYYGLRC--EYSKCVIPCKNEGRCI---G 395
            |.|.:.|.:|:...|.:.....|| |....:..|.:|..||.|  ..||....|:|.|.||   |
 Worm   121 CDEQWHGEKCDVFCCSETASRVGKVCNSHGQLGCPQGKRGLDCALPISKKWCKCQNNGACISSFG 185

  Fly   396 NNL-----CRCPNGLRGDHCE 411
            .||     |.|..|.||.|||
 Worm   186 KNLHEKMQCECQLGFRGSHCE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shfNP_001284963.1 WIF 137..258 CDD:280237
dsl-3NP_500108.1 DSL 101..163 CDD:302925 12/41 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5912
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.