DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shf and C05B5.5

DIOPT Version :9

Sequence 1:NP_001284963.1 Gene:shf / 31617 FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_499219.3 Gene:C05B5.5 / 176413 WormBaseID:WBGene00007322 Length:337 Species:Caenorhabditis elegans


Alignment Length:112 Identity:29/112 - (25%)
Similarity:43/112 - (38%) Gaps:21/112 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 SEVNYVNFTWKSGRRKYFYDFDRLQTMDES-ILKAPTLSIRKSGRIPQEQKNFSI--FLPCTGNS 228
            |.:|||:.. .:..||.|...:..:....| |.||..::|.|:       |.|::  ...||..:
 Worm    11 SSLNYVDLP-DTVHRKIFEYLNPWEIFKLSRISKAIHVTILKN-------KKFAVKDIDLCTDEN 67

  Fly   229 SGTASF----NVGL--KIQTRHNKPLSGTPIRLNFKKECAHRGVYDI 269
            .....|    |:.|  :....|.||.    ....|...|.:|..|||
 Worm    68 ILKFQFQFVNNIVLSWEFYNLHEKPY----FTSQFSNRCQYRQQYDI 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shfNP_001284963.1 WIF 137..258 CDD:280237 23/99 (23%)
C05B5.5NP_499219.3 FBOX 18..55 CDD:197608 10/44 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1225
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.