DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shf and Wif1

DIOPT Version :9

Sequence 1:NP_001284963.1 Gene:shf / 31617 FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster
Sequence 2:XP_006241457.1 Gene:Wif1 / 114557 RGDID:619774 Length:379 Species:Rattus norvegicus


Alignment Length:341 Identity:117/341 - (34%)
Similarity:172/341 - (50%) Gaps:40/341 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 ESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRV---TNDLRDTTLYNFLVIPSEVNYVNFT 175
            |..:.|||:..|.::|.      |:.|.:..:...::   |:|.|... .....||..::.:|||
  Rat    33 EESLYLWIDAHQARVLI------GFEEDILIVSEGKMAPFTHDFRKAQ-QRMPAIPVNIHSMNFT 90

  Fly   176 WK-SGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLK 239
            |: ||:.:|||:|..|:::|:.|:..||:::.:.|.:|.:.....:..||.|...|.|:|.|.:.
  Rat    91 WQASGQAEYFYEFLSLRSLDKGIMADPTVNVPRLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVI 155

  Fly   240 IQTRHNKPLSGTPIRLNFKKECAHRGVYDIDASNPTSLTTLQAPDPECSLKCGKNGYCNEHHICK 304
            :......|:..||....|.|.|.                  ||   ||...|...|:|||..:|:
  Rat   156 VMNSEGNPILRTPQNAIFFKTCQ------------------QA---ECPGGCRNGGFCNERRVCE 199

  Fly   305 CNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQC 369
            |..|:.|.:||.|.|.|:|:|||.|..|..|.||.|:.|..|:...|...|.|||.|....||.|
  Rat   200 CPDGFYGPHCEKALCIPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSATCFNGGTCFYPGKCIC 264

  Fly   370 SKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICK--C-RNGTCVSHK 431
            ..|..|.:||.|||..||:|.|:|||.:.|:||.|.:||.|     .:.:|:  | .:|||....
  Rat   265 PPGLEGEQCELSKCPQPCRNGGKCIGKSKCKCPKGYQGDLC-----SKPVCEPGCGAHGTCHEPN 324

  Fly   432 HCKCHPGFYGRHCNGR 447
            .|:|..|::|||||.|
  Rat   325 KCQCREGWHGRHCNKR 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shfNP_001284963.1 WIF 137..258 CDD:280237 34/124 (27%)
Wif1XP_006241457.1 FlaF <10..57 CDD:299725 8/29 (28%)
WIF 35..179 CDD:295401 42/168 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8964
eggNOG 1 0.900 - - E1_KOG1225
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31430
Inparanoid 1 1.050 237 1.000 Inparanoid score I3303
OMA 1 1.010 - - QHG47613
OrthoDB 1 1.010 - - D1016037at2759
OrthoFinder 1 1.000 - - FOG0007895
OrthoInspector 1 1.000 - - oto98212
orthoMCL 1 0.900 - - OOG6_109902
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.