DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shf and WIF1

DIOPT Version :9

Sequence 1:NP_001284963.1 Gene:shf / 31617 FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_009122.2 Gene:WIF1 / 11197 HGNCID:18081 Length:379 Species:Homo sapiens


Alignment Length:342 Identity:115/342 - (33%)
Similarity:170/342 - (49%) Gaps:40/342 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 EESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRV---TNDLRDTTLYNFLVIPSEVNYVNF 174
            :|..:.|||:..|.::|.      |:.|.:..:...::   |:|.|... .....||..::.:||
Human    32 QEESLYLWIDAHQARVLI------GFEEDILIVSEGKMAPFTHDFRKAQ-QRMPAIPVNIHSMNF 89

  Fly   175 TWK-SGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGL 238
            ||: :|:.:|||:|..|:::|:.|:..||:::...|.:|.:.....:..||.|...|.|:|.|.:
Human    90 TWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDV 154

  Fly   239 KIQTRHNKPLSGTPIRLNFKKECAHRGVYDIDASNPTSLTTLQAPDPECSLKCGKNGYCNEHHIC 303
            .:.......:..||....|.|.|.                  ||   ||...|...|:|||..||
Human   155 IVMNSEGNTILQTPQNAIFFKTCQ------------------QA---ECPGGCRNGGFCNERRIC 198

  Fly   304 KCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQ 368
            :|..|:.|.:||.|.|.|:|:|||.|..|..|.||.|:.|..|:...|...|.|||.|....||.
Human   199 ECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCI 263

  Fly   369 CSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICK--C-RNGTCVSH 430
            |..|..|.:||.|||..||:|.|:|||.:.|:|..|.:||.|     .:.:|:  | .:|||...
Human   264 CPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLC-----SKPVCEPGCGAHGTCHEP 323

  Fly   431 KHCKCHPGFYGRHCNGR 447
            ..|:|..|::|||||.|
Human   324 NKCQCQEGWHGRHCNKR 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shfNP_001284963.1 WIF 137..258 CDD:280237 32/124 (26%)
WIF1NP_009122.2 WIF 35..179 CDD:128745 40/168 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9740
eggNOG 1 0.900 - - E1_KOG1225
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31430
Inparanoid 1 1.050 229 1.000 Inparanoid score I3459
Isobase 1 0.950 - 0 Normalized mean entropy S5912
OMA 1 1.010 - - QHG47613
OrthoDB 1 1.010 - - D1016037at2759
OrthoFinder 1 1.000 - - FOG0007895
OrthoInspector 1 1.000 - - oto91119
orthoMCL 1 0.900 - - OOG6_109902
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4825
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.760

Return to query results.
Submit another query.