DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shf and tnca

DIOPT Version :9

Sequence 1:NP_001284963.1 Gene:shf / 31617 FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster
Sequence 2:XP_021332057.1 Gene:tnca / 100149028 ZFINID:ZDB-GENE-130530-849 Length:2336 Species:Danio rerio


Alignment Length:191 Identity:58/191 - (30%)
Similarity:79/191 - (41%) Gaps:34/191 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 CSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGIC 351
            |...|...|:|.:.. |.|:.||||:.|.:..|...|.:.|.| :..||.|..|:.|..|....|
Zfish   315 CPNDCSGRGFCIDGR-CVCDAGYTGEDCSSLTCPNNCNDRGRC-SNGVCICEVGFHGEDCGRISC 377

  Fly   352 KDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEI---- 412
            ...|.|.|.|:. .:|:|..|:.|..|....|...|.|.|||: |..|.|..|...:.|.:    
Zfish   378 PSNCNNRGHCVD-GRCECDVGFQGHDCSELSCPNNCNNRGRCV-NGQCVCDEGFGSEDCGLKTCP 440

  Fly   413 ----GRKQ----RSIC----------------KCRN-GTCVSHKHCKCHPGFYGRHCNGRK 448
                ||.|    ..:|                .|:| |.|::.: |.|..||.|..|:.||
Zfish   441 SDCYGRGQCVDGECVCFANFAGEDCSELRCPNSCQNRGRCIAGQ-CVCDEGFTGEDCSQRK 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shfNP_001284963.1 WIF 137..258 CDD:280237
tncaXP_021332057.1 EGF_2 189..217 CDD:285248
EGF_2 316..341 CDD:285248 9/25 (36%)
EGF_2 377..403 CDD:285248 9/26 (35%)
EGF_2 408..434 CDD:285248 10/26 (38%)
EGF_2 470..496 CDD:285248 9/26 (35%)
EGF_2 496..527 CDD:285248 3/5 (60%)
EGF_2 530..558 CDD:285248
FN3 593..679 CDD:238020
fn3 682..763 CDD:306538
fn3 772..852 CDD:306538
FN3 862..947 CDD:238020
FN3 954..1036 CDD:238020
FN3 1087..1171 CDD:238020
fn3 1210..1289 CDD:306538
fn3 1301..1376 CDD:306538
fn3 1392..1464 CDD:306538
FN3 1486..1570 CDD:238020
fn3 1574..1649 CDD:306538
fn3 1665..1740 CDD:306538
fn3 1756..1829 CDD:306538
fn3 1846..1925 CDD:306538
fn3 1935..2013 CDD:306538
fn3 2023..2096 CDD:306538
FReD 2114..2323 CDD:238040
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1225
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.