DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shf and wif1

DIOPT Version :9

Sequence 1:NP_001284963.1 Gene:shf / 31617 FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001106386.1 Gene:wif1 / 100127197 XenbaseID:XB-GENE-486515 Length:374 Species:Xenopus tropicalis


Alignment Length:342 Identity:115/342 - (33%)
Similarity:174/342 - (50%) Gaps:40/342 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 EESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRV---TNDLRDTTLYNFLVIPSEVNYVNF 174
            :|..:.:||:..|.::|.      |:.|.:..:...::   |:|.|... .....||..::.:||
 Frog    27 QEDSLYMWIDAHQARVLI------GFEEDILIVSEGKMAPFTHDFRKAQ-QRMPAIPVNIHAMNF 84

  Fly   175 TWK-SGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGL 238
            ||: :|:.:|||:|..|:::|:.|:..||:::...|.:|.:.....:..||.||..|.|:|.|.:
 Frog    85 TWQATGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKATVVQVGFPCLGNQDGVAAFEVNV 149

  Fly   239 KIQTRHNKPLSGTPIRLNFKKECAHRGVYDIDASNPTSLTTLQAPDPECSLKCGKNGYCNEHHIC 303
            .:.......:..||....|.|.|.                  ||   :|...|...|:||:.|:|
 Frog   150 IVMNSEGNVILQTPQNAIFFKTCQ------------------QA---KCPGGCRNGGFCNDRHVC 193

  Fly   304 KCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQ 368
            :|..|:.|.:||.|.|.|:|:|||.|..|.:|.||.||.|..|:...|...|||||.|....||.
 Frog   194 ECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVNCTTHCLNGGTCFYPGKCI 258

  Fly   369 CSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICK--C-RNGTCVSH 430
            |..||.|.:||.|||..||:|.|:|.|.|.|:|..|.:||.|     .:.:|:  | .:|||:..
 Frog   259 CPSGYEGEQCETSKCQQPCRNGGKCSGRNKCKCSKGYQGDLC-----SKPVCEPSCGSHGTCIEP 318

  Fly   431 KHCKCHPGFYGRHCNGR 447
            ..|:|..|:.||:||.|
 Frog   319 NKCQCKEGWNGRYCNKR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shfNP_001284963.1 WIF 137..258 CDD:280237 33/124 (27%)
wif1NP_001106386.1 WIF 30..174 CDD:383058 40/168 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9519
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H31430
Inparanoid 1 1.050 233 1.000 Inparanoid score I3339
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016037at2759
OrthoFinder 1 1.000 - - FOG0007895
OrthoInspector 1 1.000 - - oto104896
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.