DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14439 and YBR219C

DIOPT Version :10

Sequence 1:NP_572347.1 Gene:CG14439 / 31614 FlyBaseID:FBgn0029898 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_009778.3 Gene:YBR219C / 852520 SGDID:S000000423 Length:127 Species:Saccharomyces cerevisiae


Alignment Length:81 Identity:15/81 - (18%)
Similarity:26/81 - (32%) Gaps:31/81 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 LFVMNNIGGNLPILVDPVAKILGY-----------------------------RGSIMIFYAGFY 443
            |..::|.||..|.|:  :..::.|                             .|::.|...|:|
Yeast     4 LNTLSNFGGTWPRLI--IMSMINYFTVYQCTIPGTNKVYVTHGGSMQACTELLNGTVTILRDGYY 66

  Fly   444 GISSILFFITCFLLEG 459
            ..:.|...:..||..|
Yeast    67 ITNLICIVVGLFLYFG 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14439NP_572347.1 MFS_spinster_like 67..457 CDD:340886 13/77 (17%)
YBR219CNP_009778.3 MFS <1..100 CDD:475125 15/81 (19%)

Return to query results.
Submit another query.