DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14439 and UNE2

DIOPT Version :9

Sequence 1:NP_001188550.1 Gene:CG14439 / 31614 FlyBaseID:FBgn0029898 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_177937.1 Gene:UNE2 / 844149 AraportID:AT1G78130 Length:490 Species:Arabidopsis thaliana


Alignment Length:350 Identity:73/350 - (20%)
Similarity:142/350 - (40%) Gaps:56/350 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 FAADKYNRVNMLTVCTVIFGIAMILQGTVKEYWQLVILRMIMAAGESGCNPLATGIMSDIFPEDK 184
            :.|.::||.:::.:...::..|..|......::|:.:.|.:...|.:...|....:::|...:..
plant    63 YMAIRHNRAHVIALGAFLWSAATFLVAFSSTFFQVAVSRALNGIGLALVAPAIQSLVADSTDDAN 127

  Fly   185 RALVMAIFNW--------GIYGGYGIAFPVGRYITKLNFWNL-GWRVCYLGAGVLTVIMAALTGT 240
            |.   ..|.|        .|.||.     ....|..|.|..: ||||.:...||::||:..|...
plant   128 RG---TAFGWLQLTANIGSILGGL-----CSVLIAPLTFMGIPGWRVAFHIVGVISVIVGVLVRV 184

  Fly   241 TLREPERKAIG-EGDRQTSSGKP--VSLWQVIKNPAMIMLMIAASIRHCGGMT--FAYNADLYYN 300
            ...:|.....| :...|..|.||  ..:..:::....::.:.:..|....|:|  |.::| |.:.
plant   185 FANDPHFVKDGVDVSNQPGSRKPFCTEVKDLVREADTVIKIRSFQIIVAQGVTGSFPWSA-LSFA 248

  Fly   301 TYFPDVDLGW------WLFGVTIGIGSVGVVVGGIVSDKIVAKMGIRSRAFVLAVSQ-------- 351
            ..:.:: :|:      :|.|:.:...|:|.:.||.:.|.:..::....|..:..:|.        
plant   249 PMWLEL-IGFSHGKTAFLMGLFVAASSLGGLFGGKMGDFLSTRLPNSGRIILAQISSASAIPLAA 312

  Fly   352 -LIATLPAFGSVYFDPLWA------MITLGLSYFF-AEMWFGIVFAIVVEIVPLRVRSSTIGVFL 408
             |:..||.      ||..|      ::.|||...: |......:||   ||||.:.|:|...:..
plant   313 ILLLVLPD------DPSTAAIHGLILVLLGLFVSWNAPATNNPIFA---EIVPEKSRTSVYALDK 368

  Fly   409 FVMNNIGGNLPILVDPVAK-ILGYR 432
            ...:.:....|.:|..:|: :.||:
plant   369 SFESILSSFAPPIVGILAQHVYGYK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14439NP_001188550.1 MFS_1 94..416 CDD:284993 68/331 (21%)
MFS 107..452 CDD:119392 73/349 (21%)
UNE2NP_177937.1 MFS 8..389 CDD:119392 71/344 (21%)
MFS_1 13..379 CDD:284993 68/334 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.