DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14439 and spin

DIOPT Version :9

Sequence 1:NP_001188550.1 Gene:CG14439 / 31614 FlyBaseID:FBgn0029898 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_524823.1 Gene:spin / 45380 FlyBaseID:FBgn0086676 Length:630 Species:Drosophila melanogaster


Alignment Length:373 Identity:79/373 - (21%)
Similarity:162/373 - (43%) Gaps:68/373 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LGIDYQILAGPTFILIFTIAGVFMGFAADKYNRVNMLTVCTVIFGIAMILQGTVKEYWQLVILRM 159
            :|.|...|....|::.:.:.....|:..|:|:|..::.|...::....:|...:|::...:..|.
  Fly   147 IGNDSAGLLQTVFVISYMVCAPIFGYLGDRYSRPWIMAVGVGLWSTTTLLGSFMKQFGWFIAFRA 211

  Fly   160 IMAAGESGCNPLATGIMSDIFPEDKRALVMAIFNWGIYGGYGIAFPVGRYITKL-NFWNLGWRVC 223
            ::..||:..:.:|..|:||:|..|.|:.::|:|.:.|..|.|:.:.||.....| |.|....||.
  Fly   212 LVGIGEASYSTIAPTIISDLFVHDMRSKMLALFYFAIPVGSGLGYIVGSKTAHLANDWRWALRVT 276

  Fly   224 YLGAGVLTVIMAALTGTTLREPER-KAIGEGDRQTSSGKPVSLWQVIKNPAMIM-------LMIA 280
            .: .|::.|.:..|    :::|.| .:.|..:.:.::.|. .:..:::|.:.::       :...
  Fly   277 PI-LGIVAVFLILL----IKDPVRGHSEGSHNLEATTYKQ-DIKALVRNRSFMLSTAGFTCVAFV 335

  Fly   281 ASIRHCGGMTFAY-------------NADLYYNTYFPDVDLGWWLFGV-TIGIGSVGVVVGGIVS 331
            |......|.:|.|             ..|:.:|            ||| |:..|.:||.:|..:|
  Fly   336 AGALAWWGPSFIYLGMKMQPGNENIVQDDVAFN------------FGVITMLAGLLGVPLGSFLS 388

  Fly   332 ----------DKIVAKMGIRSRAFVLAVSQLIATLPAFGSVYFDPLWAMITLGLSYFFAEMWFGI 386
                      |.::...|:...|.:|..:.|:....:.|:      :|:|      ||.::...:
  Fly   389 QYLVKRYPTADPVICAFGLLVSAPLLTGACLLVNSNSVGT------YALI------FFGQLALNL 441

  Fly   387 VFAIVVEI---VPLRVRSSTIGVFLFVMNNIGGNL--PILVDPVAKIL 429
            .:|||.:|   |.:..|.||...|..::::..|:.  |.||..:::.:
  Fly   442 NWAIVADILLYVVVPTRRSTAEAFQILISHALGDAGSPYLVGAISEAI 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14439NP_001188550.1 MFS_1 94..416 CDD:284993 75/356 (21%)
MFS 107..452 CDD:119392 76/361 (21%)
spinNP_524823.1 MFS 117..489 CDD:119392 79/371 (21%)
MFS_1 120..462 CDD:284993 73/344 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.