DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14439 and CG9826

DIOPT Version :9

Sequence 1:NP_001188550.1 Gene:CG14439 / 31614 FlyBaseID:FBgn0029898 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_611724.1 Gene:CG9826 / 37625 FlyBaseID:FBgn0034784 Length:495 Species:Drosophila melanogaster


Alignment Length:392 Identity:79/392 - (20%)
Similarity:144/392 - (36%) Gaps:102/392 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 WQL-VILRMIMAAGESGCNPLATGIMSDIFPEDKRALVMAIFNWGIYGGYGIAFPVGRYITKLNF 215
            ||: ..:|::....:....|..|..::...|.::|..:.|....|...|..:|..:...|.|   
  Fly   116 WQVFCAIRILQGLFQGVIFPCVTEHLAMWSPPEERNRLGAFSYTGTDCGTVLAMFISGMIAK--- 177

  Fly   216 WNLGW-RVCYLGAGV------LTVIMAALTGTTLREPERKAIGEGD----------RQTSSGKPV 263
            ..:|| .:.|:...:      |.:|.|:...|     |.:.:||.:          .:...|:.:
  Fly   178 GAMGWPGISYVSGSLCAAWCFLWLIFASNNAT-----ESRFVGEAECKYIESSLEHNEDFHGRTI 237

  Fly   264 SL-WQVIKNPAMIMLMIAASIRHCGG-----------MTFAYNADLYYNTYFPDVD-LGWWLFGV 315
            .: |:.|......:.::........|           |....|.::..|..|..:. |..||...
  Fly   238 PIPWRAIWTSVPFLALLVTRCAETYGLSTLQAEIPSYMNGVLNMEIQSNAVFSSLPFLAMWLLSY 302

  Fly   316 TIGIGSVGVVVGGIVSDKIVAKMGIRSRAFVLAVSQLIATLPAFGSVYFDPLWAMITLGLSYFFA 380
            ..           :::..::.|..|.|   :.||.:|..||.     ::.|..|:|.:|   |.:
  Fly   303 VY-----------LIAADVLLKKKILS---LTAVRKLFNTLS-----FWIPAAALIGIG---FLS 345

  Fly   381 EMWFGIVFAIVVEIVPLRVRS-STI--------------GVFLFVMNNIGGNLPILVDPVA-KIL 429
            |....:  |||:..|.:.|.| :||              |:.:.:.|.:...:|||...:| :|:
  Fly   346 EENKNL--AIVLMTVSVGVNSGATIGSSLNSIDLSPNHAGILIGLSNTVANVIPILTPLIAGEIV 408

  Fly   430 G---YRGSIMIFYAGFYGISSILFFI--TCFLLEG-------------KP-DEVGQPESPKSHPD 475
            .   .||...|    .:|:::::||:  ..|::.|             || |.....|.||..|.
  Fly   409 ADKHNRGQWQI----VFGLAAVIFFVGNVVFIIWGTAKAQPWDADDFLKPKDTESACEKPKITPA 469

  Fly   476 AV 477
            .|
  Fly   470 EV 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14439NP_001188550.1 MFS_1 94..416 CDD:284993 58/309 (19%)
MFS 107..452 CDD:119392 68/349 (19%)
CG9826NP_611724.1 2A0114euk 14..450 CDD:129972 71/369 (19%)
MFS 19..438 CDD:119392 70/357 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D619250at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.