DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14439 and LOC100487792

DIOPT Version :9

Sequence 1:NP_001188550.1 Gene:CG14439 / 31614 FlyBaseID:FBgn0029898 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_031761604.1 Gene:LOC100487792 / 100487792 -ID:- Length:345 Species:Xenopus tropicalis


Alignment Length:272 Identity:54/272 - (19%)
Similarity:83/272 - (30%) Gaps:92/272 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 CYLG----AGVLTVIMAALTGTTLREPERKAIGEGDRQT---------SSGKPVSLWQVIKNPAM 274
            |.|.    |..|.||..:|....:::|......|.|...         |..||:..|..    |:
 Frog     6 CQLSWIQIAPCLGVICLSLLLLFMKDPSGGNTEEEDEDDEPQVECSLFSCLKPLLTWSF----AL 66

  Fly   275 IML-MIAASIRHCGGMTFAYNADLYYNT---------------YFPDVDLGWWLFGVTIGIGSVG 323
            ||: .::....|.|  .||...|....|               |:.|       |.|...|....
 Frog    67 IMIGSLSVDFIHEG--MFAVIPDFLDRTRNETGKQWPLFLSQSYYSD-------FMVYSAIKCAA 122

  Fly   324 VVVG---GIVSDKIVAKMGIRSRAFVLAVSQLIATLPAFGSVYF--------------------- 364
            .|:|   |:...|:::|....:..:|.||. |.|..|.|....|                     
 Frog   123 DVLGMLLGMEISKLLSKEPHSAGPWVCAVG-LFAFTPIFSLFLFFIKDGIVLPCVFLFISGVFLS 186

  Fly   365 --------------DPLWAMITLGLSYFFAEMWFGIVFAIVVEIVPLRVRSSTIG---------- 405
                          .|.:..|...|..|...:..|:....::|.:.::::.|...          
 Frog   187 LNQALSEDMMLSVIRPKFYTIAGQLQAFLTRLIAGVGAPFIIEYISVKIQESNSEKTSFECMQFA 251

  Fly   406 -VFLFVMNNIGG 416
             :||.|:..|||
 Frog   252 LMFLTVVAVIGG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14439NP_001188550.1 MFS_1 94..416 CDD:284993 52/270 (19%)
MFS 107..452 CDD:119392 54/272 (20%)
LOC100487792XP_031761604.1 MFS <4..267 CDD:421695 54/272 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D619250at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.