DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL17 and RPL17A

DIOPT Version :9

Sequence 1:NP_001284961.1 Gene:RpL17 / 31613 FlyBaseID:FBgn0029897 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_012741.1 Gene:RPL17A / 853674 SGDID:S000001663 Length:184 Species:Saccharomyces cerevisiae


Alignment Length:170 Identity:98/170 - (57%)
Similarity:121/170 - (71%) Gaps:5/170 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAVIDQKECVPFRRFNG 65
            |.||...|.|.|||..|||..|||.||||.||||||....|.:||:||:.|:|.:..:||||||.
Yeast     1 MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQVLDHQRAIPFRRFNS 65

  Fly    66 GVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEANADCKGLDADRLVVHHIQVNRAQCLRRRTY 130
            .:||.||.|::..|:.|||.||.:|:..||:||.|||:.|||||.:|.|.|||||:|...|||||
Yeast    66 SIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAANAEAKGLDATKLYVSHIQVNQAPKQRRRTY 130

  Fly   131 RAHGRINPYMSSPCHVEVILTEKEELVSKATDDEPAKKKL 170
            |||||||.|.|||.|:|:::|||||.|:||     |:||:
Yeast   131 RAHGRINKYESSPSHIELVVTEKEEAVAKA-----AEKKV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL17NP_001284961.1 PTZ00178 1..162 CDD:240306 95/160 (59%)
RPL17ANP_012741.1 PTZ00178 1..178 CDD:240306 98/170 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343102
Domainoid 1 1.000 165 1.000 Domainoid score I822
eggNOG 1 0.900 - - E1_COG0091
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I898
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62162
OrthoFinder 1 1.000 - - FOG0001699
OrthoInspector 1 1.000 - - otm46496
orthoMCL 1 0.900 - - OOG6_100758
Panther 1 1.100 - - LDO PTHR11593
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2754
SonicParanoid 1 1.000 - - X1092
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.