DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL17 and AT1G27400

DIOPT Version :9

Sequence 1:NP_001284961.1 Gene:RpL17 / 31613 FlyBaseID:FBgn0029897 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_174060.1 Gene:AT1G27400 / 839630 AraportID:AT1G27400 Length:176 Species:Arabidopsis thaliana


Alignment Length:174 Identity:109/174 - (62%)
Similarity:135/174 - (77%) Gaps:3/174 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAVIDQKECVPFRRFNG 65
            |.:||:|.||:.|||||||.:||||||||.|||.||:::||.:|:|||:.||..|:.:||.||..
plant     1 MVKYSQEPDNITKSCKARGADLRVHFKNTRETAHAIRKLPLNKAKRYLEDVIAHKQAIPFTRFCR 65

  Fly    66 GVGRCAQAK-QWKTTQGRWPKKSAEFLLQLLRNAEANADCKGLDADRLVVHHIQVNRAQCLRRRT 129
            ||||.|||| :....|||||.|||:|:|.||:|||:||:.||||.|.|.:.|||||:|...||||
plant    66 GVGRTAQAKNRHSNGQGRWPAKSAQFVLDLLKNAESNAEVKGLDVDALFISHIQVNQAAKQRRRT 130

  Fly   130 YRAHGRINPYMSSPCHVEVILTEKEELVSKATDDEPAKKKLSKK 173
            ||||||||||||:|||:|:||:||||.|.|..:.:.|.|  |||
plant   131 YRAHGRINPYMSNPCHIELILSEKEEPVKKEPETQLAAK--SKK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL17NP_001284961.1 PTZ00178 1..162 CDD:240306 104/161 (65%)
AT1G27400NP_174060.1 PTZ00178 1..176 CDD:240306 109/174 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 182 1.000 Domainoid score I1020
eggNOG 1 0.900 - - E1_COG0091
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I1219
OMA 1 1.010 - - QHG62162
OrthoDB 1 1.010 - - D1362349at2759
OrthoFinder 1 1.000 - - FOG0001699
OrthoInspector 1 1.000 - - otm3568
orthoMCL 1 0.900 - - OOG6_100758
Panther 1 1.100 - - O PTHR11593
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1092
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.