DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL17 and LOC691392

DIOPT Version :9

Sequence 1:NP_001284961.1 Gene:RpL17 / 31613 FlyBaseID:FBgn0029897 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_001075994.3 Gene:LOC691392 / 691392 RGDID:1585025 Length:179 Species:Rattus norvegicus


Alignment Length:181 Identity:120/181 - (66%)
Similarity:148/181 - (81%) Gaps:4/181 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAVIDQK--ECVPFRRF 63
            |..||.:.:|..||||:||.|||||||||.|||||||.|.:.:| :|||.|..:|  :||||||:
  Rat     1 MVHYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHICKA-KYLKDVTLKKQCQCVPFRRY 64

  Fly    64 NGGVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEANADCKGLDADRLVVHHIQVNRAQCLRRR 128
            |||||||||||||..||||||||||||||.:|:|||:||:.||||.|.||:.:||||:|..:|||
  Rat    65 NGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEYIQVNKAPKMRRR 129

  Fly   129 TYRAHGRINPYMSSPCHVEVILTEKEELVSKATDDEPAKKKLSKKKLQRQK 179
            |||||||||||||||||:|:|||:||::|.| .::|.|:|||.|:||..::
  Rat   130 TYRAHGRINPYMSSPCHIEMILTKKEQIVPK-PEEEVAQKKLKKQKLMTRE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL17NP_001284961.1 PTZ00178 1..162 CDD:240306 112/162 (69%)
LOC691392XP_001075994.3 PTZ00178 1..166 CDD:240306 113/166 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362349at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.