DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL17 and RPL17

DIOPT Version :9

Sequence 1:NP_001284961.1 Gene:RpL17 / 31613 FlyBaseID:FBgn0029897 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001356484.1 Gene:RPL17 / 6139 HGNCID:10307 Length:189 Species:Homo sapiens


Alignment Length:184 Identity:125/184 - (67%)
Similarity:151/184 - (82%) Gaps:5/184 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRYSRESDNVAK-----SCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAVIDQKECVPF 60
            |.|||.:.:|..|     :||:||.|||||||||.|||||||.|.:|:|.:|||.|..||:||||
Human     1 MVRYSLDPENPTKCKWTGACKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPF 65

  Fly    61 RRFNGGVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEANADCKGLDADRLVVHHIQVNRAQCL 125
            ||:|||||||||||||..||||||||||||||.:|:|||:||:.||||.|.||:.|||||:|..:
Human    66 RRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKM 130

  Fly   126 RRRTYRAHGRINPYMSSPCHVEVILTEKEELVSKATDDEPAKKKLSKKKLQRQK 179
            ||||||||||||||||||||:|:||||||::|.|..::...|||:|:|||::||
Human   131 RRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLKKQK 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL17NP_001284961.1 PTZ00178 1..162 CDD:240306 116/165 (70%)
RPL17NP_001356484.1 PTZ00178 1..170 CDD:240306 116/168 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145058
Domainoid 1 1.000 220 1.000 Domainoid score I2634
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3045
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62162
OrthoDB 1 1.010 - - D1362349at2759
OrthoFinder 1 1.000 - - FOG0001699
OrthoInspector 1 1.000 - - oto88412
orthoMCL 1 0.900 - - OOG6_100758
Panther 1 1.100 - - LDO PTHR11593
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2754
SonicParanoid 1 1.000 - - X1092
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.