DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL17 and rpl17

DIOPT Version :9

Sequence 1:NP_001284961.1 Gene:RpL17 / 31613 FlyBaseID:FBgn0029897 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001005078.1 Gene:rpl17 / 448653 XenbaseID:XB-GENE-5859417 Length:184 Species:Xenopus tropicalis


Alignment Length:179 Identity:125/179 - (69%)
Similarity:150/179 - (83%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAVIDQKECVPFRRFNG 65
            |.|||.:.:|..|||||||.|||||||||.|||||||.|.:|:|.:|||.|..:|:||||||:||
 Frog     1 MVRYSLDPENPTKSCKARGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLKKQCVPFRRYNG 65

  Fly    66 GVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEANADCKGLDADRLVVHHIQVNRAQCLRRRTY 130
            |||||||||||..||||||||||.|||.:|:|||:||:.||||.|.||:.|||||:|..:|||||
 Frog    66 GVGRCAQAKQWDWTQGRWPKKSANFLLHILKNAESNAEVKGLDVDSLVIEHIQVNKAPKMRRRTY 130

  Fly   131 RAHGRINPYMSSPCHVEVILTEKEELVSKATDDEPAKKKLSKKKLQRQK 179
            |||||||||||||||:|:||||||::|.|..::...|||:|:|||::||
 Frog   131 RAHGRINPYMSSPCHIELILTEKEQIVPKPEEEVAQKKKISQKKLKKQK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL17NP_001284961.1 PTZ00178 1..162 CDD:240306 116/160 (73%)
rpl17NP_001005078.1 PTZ00178 1..165 CDD:240306 116/163 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 218 1.000 Domainoid score I2615
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133871
Inparanoid 1 1.050 265 1.000 Inparanoid score I2983
OMA 1 1.010 - - QHG62162
OrthoDB 1 1.010 - - D1362349at2759
OrthoFinder 1 1.000 - - FOG0001699
OrthoInspector 1 1.000 - - oto102293
Panther 1 1.100 - - LDO PTHR11593
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1092
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.