DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL17 and mRpL22

DIOPT Version :9

Sequence 1:NP_001284961.1 Gene:RpL17 / 31613 FlyBaseID:FBgn0029897 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_523379.2 Gene:mRpL22 / 32662 FlyBaseID:FBgn0030786 Length:233 Species:Drosophila melanogaster


Alignment Length:115 Identity:22/115 - (19%)
Similarity:42/115 - (36%) Gaps:20/115 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 KSAEFLLQLLRNAEANADCKG--LDADRLVV--HHIQ-----------VNRAQCLRRRTYRAHGR 135
            |...|:|:     :...|.|.  |:|.::.|  |:::           |.:.:..:.....|.||
  Fly   123 KQLNFVLK-----KGATDVKETILEAQQIAVERHNVEYKSNLWIAESFVGKGRVFKGVRRHARGR 182

  Fly   136 INPYMSSPCHVEVILTEKEELVSKATDDEPAKKKLSKKKLQRQKEKMLRS 185
            ........||..|.|.|.|.......:.:..:::......|.:..|::.|
  Fly   183 FGKVEYKHCHYFVRLEEGEPPQHYYQEPQTPEQQYESWMEQMRSRKIINS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL17NP_001284961.1 PTZ00178 1..162 CDD:240306 19/90 (21%)
mRpL22NP_523379.2 Ribosomal_L22 95..197 CDD:278658 16/78 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0091
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.