DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL17 and Rpl17

DIOPT Version :9

Sequence 1:NP_001284961.1 Gene:RpL17 / 31613 FlyBaseID:FBgn0029897 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_017173407.1 Gene:Rpl17 / 319195 MGIID:2448270 Length:201 Species:Mus musculus


Alignment Length:152 Identity:107/152 - (70%)
Similarity:130/152 - (85%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NTHETAQAIKRMPLRRAQRYLKAVIDQKECVPFRRFNGGVGRCAQAKQWKTTQGRWPKKSAEFLL 92
            ||.|||||||.|.:|:|.:|||.|..:|:||||||:|||||||||||||..||||||||||||||
Mouse    45 NTRETAQAIKGMHIRKATKYLKDVTLKKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLL 109

  Fly    93 QLLRNAEANADCKGLDADRLVVHHIQVNRAQCLRRRTYRAHGRINPYMSSPCHVEVILTEKEELV 157
            .:|:|||:||:.||||.|.||:.|||||:|..:||||||||||||||||||||:|:||||||::|
Mouse   110 HMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMILTEKEQIV 174

  Fly   158 SKATDDEPAKKKLSKKKLQRQK 179
            .|..::...|||:|:|||::||
Mouse   175 PKPEEEVAQKKKISQKKLKKQK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL17NP_001284961.1 PTZ00178 1..162 CDD:240306 98/133 (74%)
Rpl17XP_017173407.1 PTZ00178 45..182 CDD:240306 98/136 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835168
Domainoid 1 1.000 219 1.000 Domainoid score I2627
eggNOG 1 0.900 - - E1_COG0091
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 265 1.000 Inparanoid score I3039
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62162
OrthoDB 1 1.010 - - D1362349at2759
OrthoFinder 1 1.000 - - FOG0001699
OrthoInspector 1 1.000 - - otm42393
orthoMCL 1 0.900 - - OOG6_100758
Panther 1 1.100 - - LDO PTHR11593
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2754
SonicParanoid 1 1.000 - - X1092
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.