DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL17 and Rpl17

DIOPT Version :9

Sequence 1:NP_001284961.1 Gene:RpL17 / 31613 FlyBaseID:FBgn0029897 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_958818.1 Gene:Rpl17 / 291434 RGDID:1303019 Length:184 Species:Rattus norvegicus


Alignment Length:179 Identity:125/179 - (69%)
Similarity:151/179 - (84%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAVIDQKECVPFRRFNG 65
            |.|||.:.:|..||||:||.|||||||||.|||||||.|.:|:|.:|||.|..:|:||||||:||
  Rat     1 MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLKKQCVPFRRYNG 65

  Fly    66 GVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEANADCKGLDADRLVVHHIQVNRAQCLRRRTY 130
            |||||||||||..||||||||||||||.:|:|||:||:.||||.|.||:.|||||:|..:|||||
  Rat    66 GVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTY 130

  Fly   131 RAHGRINPYMSSPCHVEVILTEKEELVSKATDDEPAKKKLSKKKLQRQK 179
            |||||||||||||||:|:||||||::|.|..::...|||:|:|||::||
  Rat   131 RAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLKKQK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL17NP_001284961.1 PTZ00178 1..162 CDD:240306 116/160 (73%)
Rpl17NP_958818.1 PTZ00178 1..165 CDD:240306 116/163 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..184 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338766
Domainoid 1 1.000 219 1.000 Domainoid score I2554
eggNOG 1 0.900 - - E1_COG0091
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 265 1.000 Inparanoid score I2977
OMA 1 1.010 - - QHG62162
OrthoDB 1 1.010 - - D1362349at2759
OrthoFinder 1 1.000 - - FOG0001699
OrthoInspector 1 1.000 - - otm44458
orthoMCL 1 0.900 - - OOG6_100758
Panther 1 1.100 - - LDO PTHR11593
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1092
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.