DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL17 and Mrpl22

DIOPT Version :9

Sequence 1:NP_001284961.1 Gene:RpL17 / 31613 FlyBaseID:FBgn0029897 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001099251.1 Gene:Mrpl22 / 287302 RGDID:1309277 Length:206 Species:Rattus norvegicus


Alignment Length:209 Identity:45/209 - (21%)
Similarity:73/209 - (34%) Gaps:67/209 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PNLRVHFKNTHETAQAIKRMP------------LRRAQRYLKAVIDQKECVPFRRFNGGVGRCAQ 72
            ||||:.      |.|.::.:|            .||.::..|.|...:  :|     |...|.|:
  Rat    15 PNLRIW------TTQMLRVLPQSCIHTSTSLDISRRWEKKNKIVYPPQ--LP-----GEPRRPAE 66

  Fly    73 AKQWKTTQGRWPKKSAEFLLQLLRNAEANA--------DCKG--------LDADRLVV--HHIQV 119
            ....: .|.::.|....:|.:|:|....:.        |.||        |:|..:.|  |:::.
  Rat    67 IYHCR-RQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAQIIKEVLLEAQDMAVRDHNVEF 130

  Fly   120 -----------NRAQCLRRRTYRAHGRINPYMSSPCHVEVILTEKEELVSKATDDEPAKKKLSKK 173
                       .|.|||:|..|...||........||..|          |..:..|.:.:..:.
  Rat   131 RSNLHIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFV----------KLVEGPPPRPEAPRT 185

  Fly   174 KLQRQKE--KMLRS 185
            .:...||  :.|||
  Rat   186 AVDHAKEYIQQLRS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL17NP_001284961.1 PTZ00178 1..162 CDD:240306 39/182 (21%)
Mrpl22NP_001099251.1 Ribosomal_L22 69..172 CDD:395181 23/113 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0091
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.