DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL17 and rpl1701

DIOPT Version :9

Sequence 1:NP_001284961.1 Gene:RpL17 / 31613 FlyBaseID:FBgn0029897 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_595711.1 Gene:rpl1701 / 2540358 PomBaseID:SPBC2F12.04 Length:187 Species:Schizosaccharomyces pombe


Alignment Length:162 Identity:90/162 - (55%)
Similarity:111/162 - (68%) Gaps:0/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAVIDQKECVPFRRFNG 65
            |.|||.......|..||||..||.||||:.|.|..|..|.|::|..:|..|.:.|:.||||||||
pombe     1 MVRYSASPALETKCAKARGAYLRTHFKNSREVAFTINGMSLKKAFIFLDNVKEHKQAVPFRRFNG 65

  Fly    66 GVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEANADCKGLDADRLVVHHIQVNRAQCLRRRTY 130
            ||||.||.|::..||.|||.||.:|...||:||||||:.||||.|:|::.|:|||.|...|||||
pombe    66 GVGRTAQGKEFGVTQARWPVKSVKFFYDLLKNAEANAEAKGLDMDKLIIKHVQVNAAPKQRRRTY 130

  Fly   131 RAHGRINPYMSSPCHVEVILTEKEELVSKATD 162
            |||||:..|:|||.|:|:|:.|:||.|.||.|
pombe   131 RAHGRVTAYLSSPSHIEIIVAEEEEAVPKAND 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL17NP_001284961.1 PTZ00178 1..162 CDD:240306 89/160 (56%)
rpl1701NP_595711.1 PTZ00178 1..176 CDD:240306 90/162 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 163 1.000 Domainoid score I959
eggNOG 1 0.900 - - E1_COG0091
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 182 1.000 Inparanoid score I1112
OMA 1 1.010 - - QHG62162
OrthoFinder 1 1.000 - - FOG0001699
OrthoInspector 1 1.000 - - otm46990
orthoMCL 1 0.900 - - OOG6_100758
Panther 1 1.100 - - LDO PTHR11593
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2754
SonicParanoid 1 1.000 - - X1092
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.