DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL17 and Mrpl22

DIOPT Version :9

Sequence 1:NP_001284961.1 Gene:RpL17 / 31613 FlyBaseID:FBgn0029897 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_017169936.1 Gene:Mrpl22 / 216767 MGIID:1333794 Length:223 Species:Mus musculus


Alignment Length:116 Identity:26/116 - (22%)
Similarity:42/116 - (36%) Gaps:36/116 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KKSAEFLLQLLRNAEANADCKGLDADRLVV--HHIQV-----------NRAQCLRRRTYRAHGRI 136
            ||.|:.:.::|           |:|..:.|  |:::.           .|.|||:|..|...||.
Mouse   122 KKGAQIIKEVL-----------LEAQDMAVRDHNVEFRSNLHIAESTSGRGQCLKRIRYHGRGRF 175

  Fly   137 NPYMSSPCHVEVILTEKEELVSKATDDEPAKKKLSKKKLQRQKE--KMLRS 185
            .......||..|          |..:..|...::.|..:...|:  :.|||
Mouse   176 GIMEKVYCHYFV----------KLVEGPPPPPEVPKTAVDHAKDYIQQLRS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL17NP_001284961.1 PTZ00178 1..162 CDD:240306 20/89 (22%)
Mrpl22XP_017169936.1 Ribosomal_L22 86..189 CDD:376305 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0091
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.