DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL17 and RPL17-C18orf32

DIOPT Version :9

Sequence 1:NP_001284961.1 Gene:RpL17 / 31613 FlyBaseID:FBgn0029897 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001186284.1 Gene:RPL17-C18orf32 / 100526842 HGNCID:44661 Length:228 Species:Homo sapiens


Alignment Length:175 Identity:122/175 - (69%)
Similarity:143/175 - (81%) Gaps:0/175 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAVIDQKECVPFRRFNG 65
            |.|||.:.:|..||||:||.|||||||||.|||||||.|.:|:|.:|||.|..||:||||||:||
Human     1 MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPFRRYNG 65

  Fly    66 GVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEANADCKGLDADRLVVHHIQVNRAQCLRRRTY 130
            |||||||||||..||||||||||||||.:|:|||:||:.||||.|.||:.|||||:|..:|||||
Human    66 GVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTY 130

  Fly   131 RAHGRINPYMSSPCHVEVILTEKEELVSKATDDEPAKKKLSKKKL 175
            |||||||||||||||:|:||||||::|.|..::...||||....|
Human   131 RAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKLRSSSL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL17NP_001284961.1 PTZ00178 1..162 CDD:240306 117/160 (73%)
RPL17-C18orf32NP_001186284.1 PTZ00178 1..175 CDD:240306 121/173 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145059
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0091
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H133871
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362349at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100758
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.