DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3168 and AT4G08878

DIOPT Version :9

Sequence 1:NP_001284957.1 Gene:CG3168 / 31612 FlyBaseID:FBgn0029896 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_680668.1 Gene:AT4G08878 / 826464 AraportID:AT4G08878 Length:280 Species:Arabidopsis thaliana


Alignment Length:278 Identity:67/278 - (24%)
Similarity:113/278 - (40%) Gaps:60/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 GLVSTSEEMDVISM--------SFILPSAECDLDLNTETKGWLNSIIFIGMMVGAYFWGSIADSF 214
            |..:.|.::.|||:        .:.:|.:.....|.......::.:.|.|..:|..|:|.:.|..
plant    13 GFFTDSYDLFVISLITKLLGRIYYQVPGSSSPGSLPDGISVAVSGVAFAGTFLGQIFFGCLGDKL 77

  Fly   215 GRKKVLIVISFMNAFCIVASSFS---------QTYSFFMLFRFLNGAALGGSGPVIWSYFAEFQP 270
            |||:|..:...:...|.:|||.|         .|..|   |||..|..:||..|:..:...|:..
plant    78 GRKRVYGLTLLIMTICSIASSLSFGKDPKTVMVTLCF---FRFWLGFGIGGDYPLSATIMFEYAN 139

  Fly   271 KAKRGSMLSFMAAFWTFGNLFVASLAWLI-------------IPRTIGFTTPYFTYNSWRIFLLV 322
            |..||:.::.:.|....|.|....::.|:             |......|.|...| .|||.|:|
plant   140 KRTRGAFIASVFAMQGVGILAAGGVSLLVSYLFEIEFPSRAYILDGAASTVPQADY-VWRIILMV 203

  Fly   323 CSLPSFLVGFLLFYLPESPKF--LLTRGKKDRALAIFRGIFVTNTKRRPDEYMVYDLEVDEK--- 382
            .:||:.|..:....:||:.::  |:.:..:..||.:.:.||.               |||||   
plant   204 GALPALLTYYWRMKMPETARYTALVAKNAEQAALDMNKEIFT---------------EVDEKRFA 253

  Fly   383 --LLESNGNVKNKYSRMI 398
              :.:|    :|.:||.:
plant   254 LTICQS----ENWFSRFV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3168NP_001284957.1 2A0115 149..598 CDD:273327 67/278 (24%)
MFS 154..623 CDD:119392 67/278 (24%)
AT4G08878NP_680668.1 MFS 13..>172 CDD:119392 39/161 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D724235at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.