DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3168 and CG5592

DIOPT Version :9

Sequence 1:NP_001284957.1 Gene:CG3168 / 31612 FlyBaseID:FBgn0029896 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster


Alignment Length:455 Identity:101/455 - (22%)
Similarity:179/455 - (39%) Gaps:111/455 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 IIFIGMMVGAYFWGSIADSFGRKKVLIVISFMNAFCIVASSFSQTYSFFMLFRFLNGAALGGSGP 259
            :.|:|.:||...:|.|.|..||...|.:.:..:......|...:.:..|...||:.|.::.....
  Fly   145 VYFVGCIVGCLCFGFITDHSGRLPALFLANSCSMIGGCVSVVCKDFPCFAASRFVAGLSMNYCFV 209

  Fly   260 VIWSYFAE---FQPKAKRGSM-LSFMAAFWTFGNLFVASLAWLIIPRTIGFTTPYFTYNSWRIFL 320
            .|:....|   .:.:...|:: |:|   |:|.|...:..||::|              ::||.:.
  Fly   210 PIYILTLENVGIKYRTLVGNLALTF---FFTLGACLLPWLAYVI--------------SNWRHYA 257

  Fly   321 LVCSLPSFLVGFLLFYLPESPKFLLTRGKKDRALAIFRGIFVTNTKRRPDEYM-----VYDLEVD 380
            :|.:||...:.......||||.:|::.||.||.:.:.:.....|.|...:|..     .|:|:. 
  Fly   258 MVVALPIVFMILTSLLAPESPSWLMSVGKVDRCIEVMKEAAKANGKIISEEVWSEMRECYELKF- 321

  Fly   381 EKLLESNGNVKNKYSRMISGMVDHSRALFKS-PILRFTIVSITINFTFHIGYYGLLMWFPELFNR 444
                 :|..:..:|:         |..|||: |.|....:.|....|..:.|             
  Fly   322 -----ANEQLGKQYT---------SLDLFKTFPRLVVLTILIVTWMTVALAY------------- 359

  Fly   445 FEEYEKAFPDQSAGVCAVTDYVVNLAKEQSNNGTCSSDIPQSVFMESLISLASALPANLLAILGM 509
                     |....|..:.|                :||..:..:.||:.    :||.::.:|.:
  Fly   360 ---------DAHVRVVEILD----------------TDIFITFSLSSLVE----IPAGIVPMLLL 395

  Fly   510 DMLGRKFFLIAGTMTAGICSALMYFVRSSVQNLVVSAIFSGAISAANAALDCLI----------- 563
            |.:|||..:.|..:   :|:|...||          .|..|..:|:.||:....           
  Fly   396 DRIGRKPMMSAVML---LCAASSLFV----------GILKGHWNASTAAIAARFFATMAYNVGQQ 447

  Fly   564 --TEVFPTKLRATGVAISMVAARLGGIIGNIVIAQLLDNYCPSPTFIVSGLLIGGGLMCLLLPNT 626
              :|:.||.||..|:||..:..::|.::..:|:: ....|.|.|.||::.:.:.|.|:.|.||.|
  Fly   448 WASEILPTVLRGQGLAIINIMGQMGALLSPLVLS-THRYYRPLPMFIITLVSVIGALIILFLPET 511

  Fly   627  626
              Fly   512  511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3168NP_001284957.1 2A0115 149..598 CDD:273327 90/425 (21%)
MFS 154..623 CDD:119392 98/450 (22%)
CG5592NP_647996.1 2A0119 17..519 CDD:273328 101/455 (22%)
MFS 141..509 CDD:119392 98/451 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.