DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14442 and Zfp821

DIOPT Version :9

Sequence 1:NP_572342.1 Gene:CG14442 / 31609 FlyBaseID:FBgn0029893 Length:1034 Species:Drosophila melanogaster
Sequence 2:NP_001161418.1 Gene:Zfp821 / 75871 MGIID:1923121 Length:413 Species:Mus musculus


Alignment Length:114 Identity:42/114 - (36%)
Similarity:62/114 - (54%) Gaps:8/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 QRWNESPEARQRRLARNAERMRERRQRESEEEYRKRLLRNAEANRQRRQNESDIERAMRLVRNAA 209
            :|.||..|.|.:||.|.....:.||..|:.||...|.:|:.||.|.:|..|:|.:||.||.|:..
Mouse   262 RRQNEPLEVRLQRLERERTAKKSRRDNETPEEREVRRMRDREAKRLQRMQETDEQRARRLQRDRE 326

  Fly   210 RQRLRRAMESPDQRAKRLAKLAERMRMYRASETNDQRKLRLAEMAARAR 258
            ..||:||.|:|::|..||.:..|..|:        :|:|...:|..||:
Mouse   327 AMRLKRANETPEKRQARLIREREAKRL--------KRRLEKMDMMLRAQ 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14442NP_572342.1 PRK11675 <692..>709 CDD:183272
Zfp821NP_001161418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..83
C2H2 Zn finger 121..141 CDD:275368
zf-C2H2 151..173 CDD:333835
C2H2 Zn finger 153..173 CDD:275368
DUF460 <243..383 CDD:391696 42/114 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..320 15/40 (38%)
DUF1682 <290..355 CDD:369610 26/72 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838535
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42533
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.890

Return to query results.
Submit another query.