DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14442 and Zfp639

DIOPT Version :9

Sequence 1:NP_572342.1 Gene:CG14442 / 31609 FlyBaseID:FBgn0029893 Length:1034 Species:Drosophila melanogaster
Sequence 2:NP_001155290.1 Gene:Zfp639 / 67778 MGIID:1915028 Length:485 Species:Mus musculus


Alignment Length:266 Identity:53/266 - (19%)
Similarity:90/266 - (33%) Gaps:70/266 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   738 QASQQHHQELSQIHVHSTADGDSRTPVLTPRRSGANKYETEEEKRIRLDKMAAHQRAVRANETPE 802
            ::..||.||.|.|.||::.|    .|:.....:.:..|:.|.|..      ::.....:|:|.|.
Mouse   118 ESVHQHTQEESPIEVHTSED----VPIAVEVHAISEDYDIEAENN------SSESLQDQADEEPP 172

  Fly   803 QRATRL----QKLSERARLKRAQIRATENTDERKERLSKQAEY---------ARMRRMRSHTPR- 853
            .:..::    |.|:..|:.|...:||..:...:.|.....::|         .:.:|..|:..| 
Mouse   173 AKLCKILDKGQALNVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQHVILKHKRTDSNVCRV 237

  Fly   854 SSSATSTEF----RAKTEEEDE--CQ---------------DDDTSAEHHMYESEAVSVTGTGSD 897
            ...:.||..    .||..|||.  |:               ..||....|:|..|...|..:.|.
Mouse   238 CKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIADTHFSDHLYWCEQCDVQFSSSS 302

  Fly   898 GGFVSVVKADNDDSPLGGGDGSNDHEQLPALQLQQHELQQIAGSLQQQHLVPHPHHEAIVLNQQH 962
            ..::...:...|:..|              .|..:||...           |...|..:|.....
Mouse   303 ELYLHFQEHSRDEQYL--------------CQFCEHETGD-----------PEDLHSHVVNEHAR 342

  Fly   963 RLVTIS 968
            ||:.:|
Mouse   343 RLIELS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14442NP_572342.1 PRK11675 <692..>709 CDD:183272
Zfp639NP_001155290.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..80
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..136 8/17 (47%)
C2H2 Zn finger 235..255 CDD:275368 5/19 (26%)
C2H2 Zn finger 262..283 CDD:275368 2/20 (10%)
C2H2 Zn finger 291..307 CDD:275368 3/15 (20%)
Interaction with CTNNA2. /evidence=ECO:0000250 371..455
C2H2 Zn finger 376..397 CDD:275368
C2H2 Zn finger 405..425 CDD:275368
zf-C2H2_8 408..481 CDD:406359
C2H2 Zn finger 433..454 CDD:275368
C2H2 Zn finger 462..482 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838541
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.