DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14442 and ZNF649

DIOPT Version :9

Sequence 1:NP_572342.1 Gene:CG14442 / 31609 FlyBaseID:FBgn0029893 Length:1034 Species:Drosophila melanogaster
Sequence 2:NP_075562.2 Gene:ZNF649 / 65251 HGNCID:25741 Length:505 Species:Homo sapiens


Alignment Length:238 Identity:40/238 - (16%)
Similarity:86/238 - (36%) Gaps:43/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 QQHLHQQQQDQLQFQQQHLQLYAPLKQQQLQQQQSQQ------PPTPLGPTSSA------SSASI 135
            :..:|.....:::....|||  .||:.|::.::..|:      ..:.||.|:.:      ..|..
Human    70 EDEIHSPAHPEIEKADDHLQ--QPLQNQKILKRTGQRYEHGRTLKSYLGLTNQSRRYNRKEPAEF 132

  Fly   136 TGAST---TGHQQRWN--ESPEARQRRLARNAERMRERRQRESEEEYR-----KRLLRNAEANRQ 190
            .|...   ..|:|...  |.||:| :.::..::.::.::....|:.:.     |..|:.::....
Human   133 NGDGAFLHDNHEQMPTEIEFPESR-KPISTKSQFLKHQQTHNIEKAHECTDCGKAFLKKSQLTEH 196

  Fly   191 RRQNESDIERAMRLVRNAARQRLRRAMESPDQRAKRLAKLAERMRMYRASETNDQRKLRLAEMAA 255
            :|.:.........|...|..::.|               |.|..|.:|..:.:.   ..|...|.
Human   197 KRIHTGKKPHVCSLCGKAFYKKYR---------------LTEHERAHRGEKPHG---CSLCGKAF 243

  Fly   256 RARQRIANESPEERKERLRKLNDYAKKVREKKKVLKHVVVHGG 298
            ..|.|:.......:.|:....::..|....|.::.:|..:|.|
Human   244 YKRYRLTEHERAHKGEKPYGCSECGKAFPRKSELTEHQRIHTG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14442NP_572342.1 PRK11675 <692..>709 CDD:183272
ZNF649NP_075562.2 KRAB 8..68 CDD:214630
KRAB 8..47 CDD:279668
C2H2 Zn finger 180..200 CDD:275368 3/19 (16%)
zf-H2C2_2 193..215 CDD:290200 2/21 (10%)
C2H2 Zn finger 208..228 CDD:275368 6/34 (18%)
C2H2 Zn finger 236..256 CDD:275368 4/19 (21%)
COG5048 260..>321 CDD:227381 5/27 (19%)
C2H2 Zn finger 264..284 CDD:275368 3/19 (16%)
zf-H2C2_2 276..301 CDD:290200 3/11 (27%)
C2H2 Zn finger 292..312 CDD:275368
zf-H2C2_2 305..329 CDD:290200
C2H2 Zn finger 320..340 CDD:275368
zf-H2C2_2 332..357 CDD:290200
C2H2 Zn finger 348..368 CDD:275368
C2H2 Zn finger 376..396 CDD:275368
zf-H2C2_2 389..413 CDD:290200
C2H2 Zn finger 404..424 CDD:275368
C2H2 Zn finger 432..452 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148428
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.