DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14442 and VAT1L

DIOPT Version :10

Sequence 1:NP_572342.1 Gene:CG14442 / 31609 FlyBaseID:FBgn0029893 Length:1034 Species:Drosophila melanogaster
Sequence 2:NP_065978.1 Gene:VAT1L / 57687 HGNCID:29315 Length:419 Species:Homo sapiens


Alignment Length:64 Identity:12/64 - (18%)
Similarity:30/64 - (46%) Gaps:10/64 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 EERKERLRKLND---YAKKVREKKKVLKHVVVHGGSSSVVVSTPTSSSSSTDQQHHHQQQQQQQ 327
            ||.||.:::::|   ..|.:.:.:|....::.:.       ||.||.:...::.|....:.:::
Human   358 EEVKEAMQRIHDRGNIGKLILDVEKTPTPLMAND-------STETSEAGEEEEDHEGDSENKER 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14442NP_572342.1 PRK12705 153..>282 CDD:237178 5/17 (29%)
VAT1LNP_065978.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
MDR3 43..380 CDD:176236 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 384..419 5/38 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.