DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14442 and ikzf4

DIOPT Version :9

Sequence 1:NP_572342.1 Gene:CG14442 / 31609 FlyBaseID:FBgn0029893 Length:1034 Species:Drosophila melanogaster
Sequence 2:XP_005162323.1 Gene:ikzf4 / 566844 ZFINID:ZDB-GENE-180319-1 Length:572 Species:Danio rerio


Alignment Length:282 Identity:56/282 - (19%)
Similarity:86/282 - (30%) Gaps:94/282 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 PHKYAAKKQELQSDNDATVSAGGN-DNSGSVSLGHNETKVIVTTASG---------------EQK 555
            |.|:..:|....:.::|......| |..|.:.|.|.|.........|               ..:
Zfish   303 PQKFLGEKHMRLNISEAPYDLDPNPDKEGDLLLSHPEGDPAALAEMGGRFMRGPRGGSNDVDPSR 367

  Fly   556 LLKATPGQAQQLYNQF-PYLAT-FPNTTSSGNSTTSTTNVGHVGVVTAGTTTGAGGTTTTAYYPM 618
            .|:..|..|  ..::| |.::: :|:.|..|.....   .|.:.:..||...|.|          
Zfish   368 SLRMPPHSA--CLSEFTPVISSVYPHITPLGQRLNC---AGGISMGLAGREAGEG---------- 417

  Fly   619 YHNGFQIGIGPNAVPPPFTPVNFANASGGNSPGQYNILAANPTLTVTGLGQQEQQQTGASSAAAP 683
             |...           |.|....|:.|.|                       .|..|...|.|..
Zfish   418 -HEDL-----------PSTRSRAASPSNG-----------------------YQDSTDTESMAEE 447

  Fly   684 QIVTT--PVG----RGRPRKNPLPSEEQLKVNSLLEQELNQMLSAPQLATSTPRRGRPLSQASQQ 742
            |.|.|  |.|    |||.|.:|..::|       ::.|.::....|   ...|.:..|.|..:::
Zfish   448 QCVITSAPPGNLNHRGRDRHSPSHAKE-------MDIEGDREKGVP---GGLPTKASPRSPLTRE 502

  Fly   743 HHQELSQIHVHSTADGDSRTPV 764
            ..|         ..||:.| ||
Zfish   503 AMQ---------VVDGEGR-PV 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14442NP_572342.1 PRK11675 <692..>709 CDD:183272 6/16 (38%)
ikzf4XP_005162323.1 C2H2 Zn finger 130..150 CDD:275368
zf-H2C2_2 143..172 CDD:290200
COG5048 <146..337 CDD:227381 8/33 (24%)
zf-C2H2 161..183 CDD:278523
C2H2 Zn finger 163..183 CDD:275368
zf-H2C2_2 175..200 CDD:290200
C2H2 Zn finger 191..211 CDD:275368
C2H2 Zn finger 224..245 CDD:275368
C2H2 Zn finger 519..539 CDD:275368
C2H2 Zn finger 547..564 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582298
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.