DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14442 and ZNF821

DIOPT Version :9

Sequence 1:NP_572342.1 Gene:CG14442 / 31609 FlyBaseID:FBgn0029893 Length:1034 Species:Drosophila melanogaster
Sequence 2:NP_001188481.1 Gene:ZNF821 / 55565 HGNCID:28043 Length:412 Species:Homo sapiens


Alignment Length:114 Identity:42/114 - (36%)
Similarity:62/114 - (54%) Gaps:8/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 QRWNESPEARQRRLARNAERMRERRQRESEEEYRKRLLRNAEANRQRRQNESDIERAMRLVRNAA 209
            :|.||..|.|.:||.|.....:.||..|:.||...|.:|:.||.|.:|..|:|.:||.||.|:..
Human   261 RRQNEPLEVRLQRLERERTAKKSRRDNETPEEREVRRMRDREAKRLQRMQETDEQRARRLQRDRE 325

  Fly   210 RQRLRRAMESPDQRAKRLAKLAERMRMYRASETNDQRKLRLAEMAARAR 258
            ..||:||.|:|::|..||.:..|..|:        :|:|...:|..||:
Human   326 AMRLKRANETPEKRQARLIREREAKRL--------KRRLEKMDMMLRAQ 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14442NP_572342.1 PRK11675 <692..>709 CDD:183272
ZNF821NP_001188481.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..83
C2H2 Zn finger 120..140 CDD:275368
zf-C2H2 150..172 CDD:395048
C2H2 Zn finger 152..172 CDD:275368
U2AF_lg 275..>387 CDD:273727 35/100 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..319 15/40 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148416
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40456
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.