DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14442 and ZNF639

DIOPT Version :9

Sequence 1:NP_572342.1 Gene:CG14442 / 31609 FlyBaseID:FBgn0029893 Length:1034 Species:Drosophila melanogaster
Sequence 2:NP_001290354.1 Gene:ZNF639 / 51193 HGNCID:30950 Length:485 Species:Homo sapiens


Alignment Length:297 Identity:55/297 - (18%)
Similarity:94/297 - (31%) Gaps:94/297 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   738 QASQQHHQELSQIHVHSTADGDSRTPVLTPRRSGANKY--------------ETEEEKRIRLDKM 788
            ::..|..||.|.|.||:..|    .|:.....:.:..|              :|:||...:|.|:
Human   118 ESVNQQTQEESPIEVHTAED----VPIAVEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKI 178

  Fly   789 AAHQRAVRANETPEQRATRLQKLSER--------------ARLKRAQIRATENTDERKERLSKQA 839
            ....:|:  |.|.:|:...|:..|..              :.||:..|...:.||....|:.|::
Human   179 LDKSQAL--NVTAQQKWPLLRANSSGLYKCELCEFNSKYFSDLKQHMILKHKRTDSNVCRVCKES 241

  Fly   840 EYARMRRMRSHTPRSSSATSTEFRAKTEEEDE--CQ---------------DDDTSAEHHMYESE 887
            ....|..:.              .||..|||.  |:               ..||....|:|..|
Human   242 FSTNMLLIE--------------HAKLHEEDPYICKYCDYKTVIFENLSQHIADTHFSDHLYWCE 292

  Fly   888 AVSVTGTGSDGGFVSVVKADNDDSPLGGGDGSNDHEQLPALQLQQHELQQIAGSLQQQHLVPHPH 952
            ...|..:.|...::...:...|:..|              .|..:||...           |...
Human   293 QCDVQFSSSSELYLHFQEHSCDEQYL--------------CQFCEHETND-----------PEDL 332

  Fly   953 HEAIVLNQQHRLVTISQHQQQQLHQQQHPGFSKLQTV 989
            |..:|.....:|:.:|    .:.:..:|..:|.|..:
Human   333 HSHVVNEHACKLIELS----DKYNNGEHGQYSLLSKI 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14442NP_572342.1 PRK11675 <692..>709 CDD:183272
ZNF639NP_001290354.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
C2H2 Zn finger 235..255 CDD:275368 5/33 (15%)
C2H2 Zn finger 262..283 CDD:275368 2/20 (10%)
C2H2 Zn finger 291..307 CDD:275368 3/15 (20%)
Interaction with CTNNA2. /evidence=ECO:0000269|PubMed:16182284 371..455
C2H2 Zn finger 376..397 CDD:275368
C2H2 Zn finger 405..425 CDD:275368
C2H2 Zn finger 433..454 CDD:275368
C2H2 Zn finger 462..482 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.